SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000004973 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000004973
Domain Number 1 Region: 69-103
Classification Level Classification E-value
Superfamily LysM domain 0.0000876
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000004973   Gene: ENSOGAG00000005564   Transcript: ENSOGAT00000005565
Sequence length 307
Comment pep:known_by_projection scaffold:OtoGar3:GL873536.1:23894388:23900821:-1 gene:ENSOGAG00000005564 transcript:ENSOGAT00000005565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRHQNHSFPLPGVQSSGQIHAFGNCIDSDTLEEDAEVYELRSRGREKVRRSTSRDRLD
DIIVLTKDIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTET
LCPPKGRQASRHSSLLYSPEQQEILPANDSFSSSESAGSFLKEVDRDIEQIVKCTDNKRE
NLNEVVSALTAQQVRFEPDNKNTPQRKDPYYGADWGIGWWAAVVIMLIVGIITPVFYLLY
YEILARVDVSHHSTVDSSHLYSGITPPSQQREVENGIAPTKGIRFSQQEDHKLYRQDSQP
PPAQHKT
Download sequence
Identical sequences H0WSB4
ENSOGAP00000004973 ENSOGAP00000004973 XP_003786023.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]