SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005089 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005089
Domain Number 1 Region: 418-446,480-584,706-821
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.53e-54
Family Phosphate binding protein-like 0.0000000965
Further Details:      
 
Domain Number 2 Region: 52-411
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.22e-25
Family L-arabinose binding protein-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005089   Gene: ENSOGAG00000005692   Transcript: ENSOGAT00000005698
Sequence length 1332
Comment pep:known_by_projection scaffold:OtoGar3:GL873730.1:2158219:2203596:-1 gene:ENSOGAG00000005692 transcript:ENSOGAT00000005698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAGGPRGPRGPAKMLLLLALACASPFPEEVPGPGGPGGVPGGARPLNVALVFSGPAYA
AEAARLGPAVAAAVRSPGLDVRPVALVLNGSDPRSLVLQLCDLLSGLRVHGVVFEDDSRA
PAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLEEYD
WTSFVAVTTRAPGHRAFLSYIEVLTDGSMVGWEHRGALTLDPGAGEAVLSAQLRSVSAQI
RLLFCAREEAEPVFRAAEEAGLTGSGYVWFMVGPQLAGGGGSGVPGEPLLLPGGAPLPAG
LFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESLHRY
FMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYGRFL
QPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPEKRC
CKGFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSLTIN
EERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFI
FEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVLVWA
FFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEKNIR
SNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGSGKV
FATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKLDID
NMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAEAAP
PPAKPPPPPQPLPSPAYPTARPAPGPAPFVPRERAAVDRWRRTKGAGPPGGAGLADGFHR
YYGPIEPQGLGLGLGEARAAPRGAAGRPLSPPAAQPPQKPPPSYFAIVRDKEPAEPPAGA
FPGFPSPPAPPAAAATAVGPSLCRLAFEDESPPAPARWPRSDPESQPLLGPGAGGAGGAG
ASGGGAPAAPPPCRAAPPPCPYLDLEPSPSDSEDSESLGGASLGGLEPWWFADFPYPYAE
RLGPPPGRYWSVDKLGGWRAGSWDYLPPRSGPAAWHCRHCASLELLPPPRHLSCSHDGLD
GGWWAPPPPPWAAGPPPRRRARCGCPRPHPHRPRASHRAPAAAPHHHRHRRAAGGWDLPP
PAPTSRSLEDLSSCPRAAPARRLTGPSRHARRCPHAAHWGPPLPAAPHRRHRGGDLGTRR
GSAHFSSLESEV
Download sequence
Identical sequences H0WSM1
XP_003801575.1.62490 ENSOGAP00000005089 ENSOGAP00000005089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]