SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005191 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005191
Domain Number 1 Region: 103-513
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.6e-69
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0046
Further Details:      
 
Domain Number 2 Region: 555-780
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.08e-50
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005191   Gene: ENSOGAG00000005802   Transcript: ENSOGAT00000005806
Sequence length 922
Comment pep:known_by_projection scaffold:OtoGar3:GL873538.1:19755217:19796139:-1 gene:ENSOGAG00000005802 transcript:ENSOGAT00000005806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASASVAAARRGLGRAPRLLLRRGYQTERGVYGYRPRKPEGQEPGVGLARSPDLVDHGLA
RLVTVYCEHGHKAAKINPLFAGQALLESVPEIQALVQTLQGPFNTTGLLNMGKEEASLEE
VLAYLNEIYCGQISIETAQLESQEEKDWFAKRFEELKKETFTTEERKYLSKLMLESQEFD
HFLATKFATVKRYGGEGAESMMGFFHELLKMSAYAGITDVIIGMPHRGRLNLLTGLLRFP
PELMFRKMRGLSEFPENLSVTGDVLSHLTSSVDLDFGAHHPVHVTMLPNPSHLEAVNPVA
VGKTRGRQQSRQDGDYSPDSSARPGDKVICLQVHGDASFCGQGIVPETFTLSNLPHFRIG
GSVHLIVNNQLGYTTPAERGRSSLYCSDIGKLVGSAIIHVNGDSPEEVVRATRLAFEYQR
RFRKDVIVDLFCYRQWGHNELDEPFFTNPVMYKIIRARKSIPDTYAEHLIASGLMAQEEV
SEIKSSYYAKLNNHLTDTAHYSPPATNLQAHWQGLVQPEARITTWNTGVPLDLLRFVGGK
SVEVPEELQVHSHLLKMYVQSRMEKVMEGTKLDWATAEALAFGSLLAEGFNVRLSGQDVG
RGTFSQRHAMVVCQETDDTYLPLNHMDPHQKGFLEVSNSPLSEEAVLGFEYGMSIESPKL
LPVWEAQFGDFFNGAQIIFDTFISGGEAKWLLQSGIVILLPHGYDGAGPDHSSCRIERFL
QMCDSREEGVDGDTVNMFVVYPTTPAQYFHLLRRQMVRNFRKPLIVASPKMLLRLPAAVS
ALQEMAPGTTFKAVIGDSSVDPKKVKTLVFCSGKHFYALVKQRESLGAKKDAFAIIRIEE
LCPFPLDSLQQEMSKYQHVKDLIWSQEEPQNMGPWSFVSPRFEKQLACKLRLVSRPPLPV
PAVGIGTVHLQQHEDVLTRTFT
Download sequence
Identical sequences H0WSV7
ENSOGAP00000005191 ENSOGAP00000005191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]