SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005249 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005249
Domain Number 1 Region: 25-508
Classification Level Classification E-value
Superfamily ALDH-like 1.7e-183
Family ALDH-like 0.00000000000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005249   Gene: ENSOGAG00000005864   Transcript: ENSOGAT00000005867
Sequence length 512
Comment pep:known_by_projection scaffold:OtoGar3:GL873548.1:1388442:1423278:-1 gene:ENSOGAG00000005864 transcript:ENSOGAT00000005867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTNGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATYNPSTLEKI
CDVEEGDKLDVDRAVEAAQAAFQRGSPWRQMDALSRGRLLHQLADLVERDRAILATLETM
DTGKPFLHAFFIDLEGCIKTLRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPW
NFPLLLLVWKLAPALCCGNTVVLKPAEQTPLTALYLGSLIKEVGFPPGVVNIVPGFGPTV
GAAISSHPQINKIAFTGSTQVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVE
CAHQGVFFNQGQCCTAASRVFVEEQVYTEFVRRSVEYAKKRPVGDPFDVRTEQGPQIDQK
QFDKILELIESGKNEGAKLECGGSTLGDRGFFITPTVFSEVTDNMRIAKEEIFGPVQTIL
KFKNMEEVIKRANSTDYGLTAAVFTQNLDKALKLASALESGTVWINCYNAIYAQAPFGGF
KMSGNGRELGEYALAEYTEVKTVTIKLGDKNP
Download sequence
Identical sequences H0WT05
ENSOGAP00000005249 ENSOGAP00000005249 XP_003788679.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]