SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005348 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005348
Domain Number 1 Region: 249-366,503-764
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.94e-34
Family Quinoprotein alcohol dehydrogenase-like 0.02
Further Details:      
 
Domain Number 2 Region: 681-914
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-16
Family WD40-repeat 0.022
Further Details:      
 
Domain Number 3 Region: 969-1089
Classification Level Classification E-value
Superfamily EF-hand 0.00000000818
Family Calmodulin-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005348   Gene: ENSOGAG00000005981   Transcript: ENSOGAT00000005983
Sequence length 1134
Comment pep:known_by_projection scaffold:OtoGar3:GL873618.1:2349166:2429407:1 gene:ENSOGAG00000005981 transcript:ENSOGAT00000005983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDAEETEEDGETEMEEDYNPNYKDVENTQQESQEDDTLAWSGFPDEEEGEGEEEGEEEE
EGGEEGEEREGEEKEKREEGEEEEGEEEKVQQSVKLKKKEKNFKLKIKNSLSTSYIHKTH
TGSESKHSLQSEGSETNLRRLSSGHEFYDSDETSFEEQQVSSPEIQPSGDLEEETTQMPK
DELGQEGRDLESEMEKKGQEKKVSVFLDQKAGITRQSMVSTTTEDILFQKDDSTLYPLTM
TWWFGWNSSLPVYYLREENERVLLFVCAHTAVIYNVSRNYQYHLQGHPNVISCLCVSEDR
RWIATADKGPDCLIIIWDSFTGIPVHTIFDSCPEGNGIRAIAMTRDSKYLATISDAEVQK
VCIWKWTLAVEVPACTLELPKEYGLQNHLTFNPTNDKELVSNSRTQAIYYSWYEERKILA
HSAPLLTEKTFNKLVGKFSQSVFHLNLTQILSATLEGKLVVWDIHRSPSSSSAFLGSSYI
KPCKLVHLQKEAITVLTTVDSYIVTGDIKGNIKFYDHTLSIVSWYSHLNSSPIRTLSFSK
IPASPPTEKSNYPPDCTLKGDFFVVRNLIFGTSDAAVYHLTIDGTKLEKLFVEPKDAICA
ISCHPYQSLIAIGSFCGMIKVWDYEKKKYLFSRVFEKGLGVQSLTYNPEGALLGAGFTEG
TVYILDAMSLENDTPEPFRYSRTSVTHISFSHDSQYMATADVSFTVAIYMMVVKRGKRVW
EYLARLRSHRKSIQSLLFGVHLDSNEPRLLSLGRDRLLIEYNLRRSCKDHLEVLDIHRTD
QGDYPTCMVWYPPLAKELFLLICNSGYKVKLFNSTTKMCRKTLLGPAYGSPIEQAQVLPA
RTTMELQKRYLVFINRDKVGLQILPVDGNPHKTSAIICHPNGVAGLALSYDGCYAFTAGG
HDRSVVQWKINLSALEAAVSLGGDDLIPFYGLVSGGREGKFYRELEDYFYYSQLRSQDID
TMETRKVSEHICLSELPFVMRAIGFYPSEEKIDDMFNEIKFSEYVETGKLIDKINLPDFL
KVYVNHRPPFGNTMSGVQESFNVLGYTNSKGKKAIQREDFLKLLLTKGEHMTEEEMSDCF
ATLFGLNPEGWKSEPATSSFKGAEICLEEELPDEITAEIFTTEILGLAISEDSG
Download sequence
Identical sequences H0WT89
ENSOGAP00000005348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]