SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005362 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005362
Domain Number 1 Region: 497-724
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.06e-59
Family Eukaryotic proteases 0.00000000455
Further Details:      
 
Domain Number 2 Region: 115-208
Classification Level Classification E-value
Superfamily Kringle-like 9.18e-36
Family Kringle modules 0.00000659
Further Details:      
 
Domain Number 3 Region: 210-295
Classification Level Classification E-value
Superfamily Kringle-like 8.94e-34
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 4 Region: 304-387
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-31
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 5 Region: 383-479
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-28
Family Kringle modules 0.0004
Further Details:      
 
Domain Number 6 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.33e-21
Family Hairpin loop containing domain 0.00000518
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005362   Gene: ENSOGAG00000005993   Transcript: ENSOGAT00000005999
Sequence length 732
Comment pep:known_by_projection scaffold:OtoGar3:GL873524.1:10073915:10145328:-1 gene:ENSOGAG00000005993 transcript:ENSOGAT00000005999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTQLLPVLLLQQVLLRLLLLPIAIPYAEGQKKRRNTLHEFKKSAKTTLIKEDPFLKIK
TKKMNTADQCANRCIRNKGLPFTCKAFVFEKTRKRCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGRGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCATAHSPVNDTDV
PMETTECIQGQGEGYRGTINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPD
GAESPWCFTTDPNIRVGYCTQIPNCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWEKN
MEDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIV
NLDHPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPS
RNKDLKDYEAWLGIHDVHGRGDEKRKQVLNVSQLVYGPEGSDLVLLKLARPAILDDFVNT
IDLPNYGCTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQHHQGKVTLNESE
ICAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWI
HKVILTYKVPQS
Download sequence
Identical sequences H0WTA2
ENSOGAP00000005362 ENSOGAP00000005362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]