SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005447 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005447
Domain Number 1 Region: 349-522,556-720
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.97e-83
Family YicI catalytic domain-like 0.00051
Further Details:      
 
Domain Number 2 Region: 124-347
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.39e-40
Family YicI N-terminal domain-like 0.0054
Further Details:      
 
Domain Number 3 Region: 723-819
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.15e-16
Family Putative glucosidase YicI, domain 3 0.0071
Further Details:      
 
Domain Number 4 Region: 77-136
Classification Level Classification E-value
Superfamily Trefoil 0.000000000000981
Family Trefoil 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005447   Gene: ENSOGAG00000006089   Transcript: ENSOGAT00000006098
Sequence length 952
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:2593608:2609282:-1 gene:ENSOGAG00000006089 transcript:ENSOGAT00000006098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVKWLPHARPLLGICTLICLATAALLGHILLHDFLVVPQELNSFSPGLGETHRAAQQGA
RWPGSRQAQGPPGSPAAAPPQCDVPPNSRFDCAPDKAITQEKCNARGCCYIPTKQNPQGT
RMGQPWCFFPSNYPSYKLENLSSSEMGYTATLTRSSPTFFPKDVLTLRLDVRMETESRLH
FTIKDPAKRRYEVPLATPRVHSQVPSRIYSIEFSEEPFGIVVRRKLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQYLTGLAERLGPLMLSPNWAMITLWNRDIAPKLGANLYGSHPFYLA
LEDGGLAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYVFLGPDPKSVVRQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVANMTRAHFPLDVQWNDLDYMDAGRDFTYNKDT
FRDFPAMVHELHQGGQHYVMIVDPGISSSGPPGSYRPYDEGLRRGVFITNATGQPLIGKV
WPGFTAFPDFTNPETLDWWQDMVAEFHAQVPFDGMWIDMNEPSNFVRGSVDGCPVNELES
PPYVPGVIGGSLHDATMCASSHQFLSTHYNLHNLYGLTEAIASHRALVETRGTRPFIISR
STFAGHGQYAGHWTGDVSSTWEDLSSSVSEILLFNLLGVPLVGADICGFMGNTSEELCVR
WTQLGAFYPFMRNHNNLYNMPQEPYRFSEPAQQAMRKAFALRYALLPYLYTLFYKAHVNG
ETVARPLFLEFPEDLHTWTVDRQLLWGEALLITPVLEAGKTEVTGYFPSGTWYDLQTVPV
QAFGSLPPSPPVSLRPSIHSQGQWVTLPAPLDTINLHLRAGYIIPLQGPGLTTRESRKQP
VTLVTALTNSGEAQGELFWDDGESLGVLERGAYTLVTFQAKNNTITNELVHVSTEGAGLQ
LQKVTVLGVATAPQQVLSNGVPVSNFTYSPNTEILDVPVSLSMGEQFLISWS
Download sequence
Identical sequences H0WTG7
ENSOGAP00000005447 ENSOGAP00000005447 XP_003786123.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]