SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005581 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005581
Domain Number 1 Region: 335-433
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.78e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005581   Gene: ENSOGAG00000006245   Transcript: ENSOGAT00000006251
Sequence length 1275
Comment pep:known_by_projection scaffold:OtoGar3:GL873652.1:2724613:2755459:-1 gene:ENSOGAG00000006245 transcript:ENSOGAT00000006251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRYTEFPCSPSNLTKEPMEAKPSQAPPLQDDVDMSGGSSGNEATENCSTGRDSQGSDCD
DSGKELGMLVEPPDVHQSPNAFSLMMATSEHNPSTSGCSSDQSAKANTHKELIKTLKELK
VHLPADKKAKGKASTLATLKYALKSVKQVKANEEYYQLLMSSESQPCGVDVPCYTVGEME
SMTSEYIGKNVDMFAVAVSLVTGKILYISDQVASIFHCKRDAFSDAKFVEFLAPHDVSVF
HSFTTPCKLPSWSVCGRADSFTQECMEEKSFFCRVSVGKNHENEIRYHPFRMTPYLAKVW
DQQGGERQFCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDIDERAVPLLGYLPQ
DLIETPVLLQLHPSDRPLMLAVHKKILQSGGQPFDYSPIRFRAQNGEYITLDTSWSSFIN
PWSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKAPSPSIQELTEQIHRLLLQPVPHSGS
SGYGSLGSNGSHEHLMSQTSSSDSNGHEDSHQRRAETCKSGNRTKTKSHHSPEPGEQKKK
SSSEVPSSPSAQMKAVPAAKKDSSGASFSKASMPEDLACRTQPTCSYQQISCLDSVIRYL
ESCSEAATLKRKCEFPANIPTLRSSDKRKAVISPMPTGVLSYKEAVLPSKANGHTEVRTH
LTSLALPSKAESVVSLTSQCSYSSTIVHVGDKKPQPELEMVEDSVSGPESLDCLVGPSLP
CGLNQEKEPFKKLGLTKEVLAAHTQKEEQSFLQKFKEIRKLNIFQSHCHYYLQERSKGQL
SERTASGLRNTSGIDSSWKKTGKNRKLKSKRVKPRDSSDSTGSGGPVLHRPPLLGLNATA
WSPSDTSQASCPTVPCPAPVPTFSLPVFPTAGTLAAPPAAPHASFTVPTVPMDAQNQFAV
QSPPFPTPLAPVVAFVLPSYSFPPGPPSLPQAFFPGHPHFPSHPMLVTEMTSPSQPKFPG
QTSTPRQPCTCPATPATPATPPSAVGRASPPLFQSRGSSPLQLNLLQLEETPEGGTGTAG
TVGATGIAAAGLDCKPGTSRDRQPKASPTHHESSEAQNSDALSTSSDLLNLLLNEDLCSA
SGSALSGSAASATSDSLGSSSLGGNASHSAAGSSDTSHTSKYFGSIDSSENNHRAKLNAG
MEGSEHLLKCVLQDPIWLLMADTDDSVMMTYQLPARNLETVLKEDREKLKLLQKFQPRFT
ESQKQELSEVHPWMRVGSLPTALDVAECVYCENKEKGSICVTYEEDIPSLGQSEVSDTKE
VENGPPLSHKNEEQT
Download sequence
Identical sequences H0WTT0
ENSOGAP00000005581 ENSOGAP00000005581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]