SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005654 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005654
Domain Number 1 Region: 326-382
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000000000196
Family VPS37 C-terminal domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 62-130
Classification Level Classification E-value
Superfamily UBC-like 0.00000000288
Family UBC-related 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005654   Gene: ENSOGAG00000006326   Transcript: ENSOGAT00000006330
Sequence length 398
Comment pep:known_by_projection scaffold:OtoGar3:GL873640.1:745926:783599:-1 gene:ENSOGAG00000006326 transcript:ENSOGAT00000006330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWLFPLTKSASSSASGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTINN
LTININILLPPQFPQEKPVISVYPPIRHHLMDKQGIYVTSPLVNNFTMHSDLGKIVQSLL
DEFWKNPPVLAPTSTAFPYLYSNPGGMPPYAASQGFPFLPPFPSKEANRNITSLSAADTI
SSSTTSLTPAKPAAPSFGVLSNLPLPVPTTDASAPTSQNGFGYKMPDVPDTFPELSELSV
SQLTDMNEQEDVLLDQFLNLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLD
KYELLTQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTEI
DDFLSSFMEKRTICHCRRAKEEKLQQAIAMHSQFHAPL
Download sequence
Identical sequences H0WTZ2
ENSOGAP00000005654 ENSOGAP00000005654 XP_003797697.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]