SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005710 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005710
Domain Number 1 Region: 105-289
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 6.02e-51
Family Isochorismatase-like hydrolases 0.0000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005710   Gene: ENSOGAG00000006392   Transcript: ENSOGAT00000006394
Sequence length 296
Comment pep:known_by_projection scaffold:OtoGar3:GL873522.1:46154667:46173750:-1 gene:ENSOGAG00000006392 transcript:ENSOGAT00000006394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPARQPGALRAXGGVGAGAPSGSVPVLFCFSVFARPSSVPHGAGYELLIQKFLSLYGDQI
DMHRKFVVQLFAEEWGQYVDLPKGFAVSERCKVRLVPLQIQLTTLGNLTPSSTVFFCCDM
QERFRPAIKYFGDIISVGQRLLQGARILGIPVIVTEQYPKGLGSTVQEIDLTGVKLVLPK
TKFSMVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALELVGRGVEVHIVADATSSRSM
MDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Download sequence
Identical sequences H0WU35
ENSOGAP00000005710 ENSOGAP00000005710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]