SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005805 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005805
Domain Number 1 Region: 32-144
Classification Level Classification E-value
Superfamily FKBP-like 1.02e-34
Family FKBP immunophilin/proline isomerase 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005805   Gene: ENSOGAG00000006494   Transcript: ENSOGAT00000006496
Sequence length 199
Comment pep:known_by_projection scaffold:OtoGar3:GL873589.1:9158163:9162429:-1 gene:ENSOGAG00000006494 transcript:ENSOGAT00000006496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRPSLFPLHLLLLLNGAMCRAEAGFETESPIRTLQVETLVEPPEPCAQPAAFGDTLHI
HYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKR
GFPPSIPADAVVQYDVELIALNRANYWQKLVKGILPVVGMAMVPALLGLIGYHLYKKANR
PKVSKKKLKEEKRNKSKKK
Download sequence
Identical sequences H0WUB4
XP_003793641.1.62490 ENSOGAP00000005805 ENSOGAP00000005805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]