SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005849 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005849
Domain Number 1 Region: 368-614
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.13e-79
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 196-303
Classification Level Classification E-value
Superfamily Kringle-like 6.52e-34
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 3 Region: 36-90
Classification Level Classification E-value
Superfamily Kringle-like 9.04e-19
Family Fibronectin type II module 0.0052
Further Details:      
 
Domain Number 4 Region: 96-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000005849
Domain Number - Region: 132-167
Classification Level Classification E-value
Superfamily FnI-like domain 0.00628
Family Fibronectin type I module 0.006
Further Details:      
 
Domain Number - Region: 177-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00791
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005849   Gene: ENSOGAG00000006541   Transcript: ENSOGAT00000006544
Sequence length 616
Comment pep:known_by_projection scaffold:OtoGar3:GL873780.1:252691:260821:-1 gene:ENSOGAG00000006541 transcript:ENSOGAT00000006544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLLLGSLLVNLEPTLSPPPWKAPKEDKHKVNEHTVVLTVTGEPCHFPFQYHRRLYHK
CIHKGQPGPQPWCATTPNFDQDQRWTYCLESKKVKDHCSKHSPCQKGGMCVNTLTGPHCF
CPEHLTGKHCQKEKCFEPQLLRFFRENETWYRSQLGGVAKCQCKGPDNRCQQLASQACLT
NPCLNGGRCLEAEGHHLCHCPMGYTGPFCDIDTEASCYEGHGLSYRGMAKTTLSGAQCQP
WTSEATYRNVTAEQALKWGLGGHAYCRNPDNDTRPWCFVLSGHRLSWEYCDLAPCQPPAR
TAPPIRVPPGRQDLPLPPHPSLQKPQSTTQTRPQSPTPGLLAKPEQQSSLPGTRLLGCGQ
RLRKRLSSVRRVVGGLVALPGTHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPE
ELTVVLGQDRHNQSCEQCQTLAVRSYSLHEAFSPISYQHDLALLRLQESADGNCALLSPY
VQPVCLPSSAARRAEPKAALCEVAGWGHQFEGAEEYSSFLQEAQVPFISLERCSAPDVHG
DSILPGMLCAGFLEGGTDACQGDSGGPLVCEDEAAEHRLTLRGIISWGSGCGDRNKPGVY
TDVTNYLAWIQEHTAS
Download sequence
Identical sequences H0WUE9
ENSOGAP00000005849 ENSOGAP00000005849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]