SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006207 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006207
Domain Number 1 Region: 438-768
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.26e-106
Family PDEase 0.00000125
Further Details:      
 
Domain Number 2 Region: 170-271
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.01e-17
Family Flavin-binding PAS domain 0.05
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000006207
Domain Number - Region: 45-116
Classification Level Classification E-value
Superfamily CheY-like 0.00279
Family CheY-related 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006207   Gene: ENSOGAG00000006930   Transcript: ENSOGAT00000006938
Sequence length 780
Comment pep:known_by_projection scaffold:OtoGar3:GL873536.1:11572207:11685828:1 gene:ENSOGAG00000006930 transcript:ENSOGAT00000006938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKQQRSIEQVSSAEVRIGPMRLTQDPIQVLLIFGKEDSQSDGFWWACDRAGYRCNIARTP
ESALECFLDKHHEIIVIDHRQTRNFDAEAVCRSIRATNPSEHTVILAVVPQASDDHEEAS
VLPLLHAGFNRRFMENSSIIACYNELVQIEHGEVRSQFKLRACNSVFTALDHCHEAIEIT
SDDHVIQYVNPAFERMMGYHKGELLGKELADLPKSDKNRADLLDTINTCIKKGKEWQGVY
YARRKSGDSIQQHVKITPVIGQGGKIRHFVSLKKLCCTTDNNKQIHKVHRDSGDNSQTEA
HSFRYKNRRKESIDVKSISSRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQE
NSPVTVAEALDRVLEILRTTELYSPQLGTKEEDPHTSDLVGGLMTDGLRRLSGNEYVFTK
NVHQSHSHLAMPITINDVPPCVAQLLDNEESWDFNIFELEAVTHKRPLVYLGLKVFSRFG
VCEFLNCSETTLRAWLQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQLDE
VAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDTKCNIF
KNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPLAAEIEGSDCECNPTGKNF
PENQMLIKRMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFDRN
TCSIPKSQISFIDYFITDMFDAWDAFAHLPALMQNLADNYKHWKTLDDLKCKSLRLPSDS
Download sequence
Identical sequences H0WV86
ENSOGAP00000006207 ENSOGAP00000006207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]