SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006258 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006258
Domain Number 1 Region: 12-136
Classification Level Classification E-value
Superfamily DNA clamp 7.42e-17
Family DNA polymerase processivity factor 0.015
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000006258
Domain Number - Region: 158-238
Classification Level Classification E-value
Superfamily DNA clamp 0.0942
Family DNA polymerase processivity factor 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006258   Gene: ENSOGAG00000006987   Transcript: ENSOGAT00000006993
Sequence length 417
Comment pep:known_by_projection scaffold:OtoGar3:GL873618.1:1228862:1254965:-1 gene:ENSOGAG00000006987 transcript:ENSOGAT00000006993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVAMLKCGMSGSQVKVFGKAIQALSRVSDELWLDPSEKGLALRSVNSSRSAYGCILFSPV
FFQHYQWSASVKINDKDTTFNLNCKLGMKSILPIFRCPNSLERNVEKCKIFTRSEKCKVV
IQFFCRYGIKRTHNICFQESQPLQVIFEKNMCSNTLMIQPRLLAEAVVLFTSNQEEVTLA
VTPLNFCLKSSSEESMDLTNSVYSEMFVGPDEFDYFQIGVDTEITFCFKELKGMLTFSEA
THAPISIHFDFPGKPLALSIDDMLLEANFILATLADEPSRASSPQSLCLSQKQKRSDVMQ
SNSKADEKVTSQALECLSRKAAPKRLYPEETSTNISVAANHGSPVMKRTAGDISKVPESG
VSDTEEVFRSPYLRKFSCMFFGAVSSDQQEHFNHSLDSLTRASDSDEDMNNGSFSTF
Download sequence
Identical sequences H0WVC8
ENSOGAP00000006258 ENSOGAP00000006258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]