SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006281 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006281
Domain Number 1 Region: 153-253,421-492
Classification Level Classification E-value
Superfamily TrmE connector domain 7.45e-43
Family TrmE connector domain 0.0035
Further Details:      
 
Domain Number 2 Region: 104-184,221-411
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.31e-36
Family G proteins 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006281   Gene: ENSOGAG00000007014   Transcript: ENSOGAT00000007018
Sequence length 492
Comment pep:known_by_projection scaffold:OtoGar3:GL873624.1:2670189:2673405:1 gene:ENSOGAG00000007014 transcript:ENSOGAT00000007018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRELWTLAVRAACGPRRLCTFQRSRVPALNSGTTIFALSSGQGRCGIAVIRTSGPASGY
ALGILTAPRDLPPARKASLRLLSDPRSGEPLDRALVLWFPGPQSFTGEDCVEFHVHGGPA
VVSGVLQALGSVPGLRPAEAGEFTRRAFAHGKLNLTEVEGLADLIHAETEAQRRQALRQL
DGELGHLCRGWAETLTKALAHVEAYIDFGEDDNLEEGVLEQVDSEVRALEVALQTHLGDA
RRGQRLRSGAHVVVTGPPNAGKSSLVNLLSRKPVSIVSPEPGTTRDVLETPVDLAGFPVL
LSDTAGLREGIGPVEQEGVRRAQERLEQADLILAMLDACDLASPSSRNFLDMVVAPTGAQ
NPSKSSQRLLLVLNKSDLLPSGSPSLIPDLPPYLLLSCLTGEGLDSLLEMLRKELVAVCG
DPSTGPPLLTRARHQHHLQGCLNALSHYKESKDLALAAEALRVARGHLTRLTGGGGTEEI
LDIIFQDFCVGK
Download sequence
Identical sequences H0WVE7
ENSOGAP00000006281 ENSOGAP00000006281 XP_003796592.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]