SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006316 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006316
Domain Number 1 Region: 223-286
Classification Level Classification E-value
Superfamily Leucine zipper domain 3.75e-19
Family Leucine zipper domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006316   Gene: ENSOGAG00000007056   Transcript: ENSOGAT00000007059
Sequence length 295
Comment pep:known_by_projection scaffold:OtoGar3:GL873681.1:3830892:3885730:1 gene:ENSOGAG00000007056 transcript:ENSOGAT00000007059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFCKDKEKEKKLDDESNSPTVP
QSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAA
PSVMDLSSRASAPIHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPA
DLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAK
RSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL
Download sequence
Identical sequences H0WVH8
ENSOGAP00000006316 XP_003800074.1.62490 ENSOGAP00000006316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]