SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006837 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006837
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily POZ domain 9.03e-32
Family BTB/POZ domain 0.00000103
Further Details:      
 
Domain Number 2 Region: 584-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 625-677
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 526-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000742
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000006837
Domain Number - Region: 494-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0741
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006837   Gene: ENSOGAG00000007638   Transcript: ENSOGAT00000007642
Sequence length 707
Comment pep:known_by_projection scaffold:OtoGar3:GL873579.1:9027789:9050388:1 gene:ENSOGAG00000007638 transcript:ENSOGAT00000007642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
FTDQLKCNLNVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT
CRKFIKASEAEMVPAIKPPREDFLNSRMLMPQDIMAYRGREVVESNLPLRNAPGCEGRAF
APSLYGGLSTPPASYPMYSHLPVSSFLFDEELRDARMPVANPFPKERALPCDSGRPVPGE
YSRPTMEVSPSMCHSNIYSPKETVPEEARSDMHYSVAEGPKPAAPSIRNAPYFPCDKASK
EEERPSSEDEIALHFESPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQTSGS
PPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGHLSPRAYTAPPACQPPLEPD
NLDLQTPTKLSAGGEDSTIPQASRLNNIVNRSLTGSPRSSSESHSPLYMHPPKCVSCGSQ
SPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQTH
SDKPYKCDRCQASFRYKGNLASHKTVHTVIGEKPYRCNICGAQFNRPANLKTHTRIHSGE
KPYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYH
CEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPPELPKAC
Download sequence
Identical sequences H0WWR1
ENSOGAP00000006837 ENSOGAP00000006837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]