SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006959 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006959
Domain Number 1 Region: 349-490
Classification Level Classification E-value
Superfamily C-type lectin-like 1.25e-40
Family C-type lectin domain 0.00029
Further Details:      
 
Domain Number 2 Region: 931-1083
Classification Level Classification E-value
Superfamily C-type lectin-like 1.53e-39
Family C-type lectin domain 0.00049
Further Details:      
 
Domain Number 3 Region: 645-779
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-38
Family C-type lectin domain 0.000000164
Further Details:      
 
Domain Number 4 Region: 789-925
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-37
Family C-type lectin domain 0.00026
Further Details:      
 
Domain Number 5 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2e-33
Family Cysteine rich domain 0.000000762
Further Details:      
 
Domain Number 6 Region: 1220-1360
Classification Level Classification E-value
Superfamily C-type lectin-like 2.7e-32
Family C-type lectin domain 0.00036
Further Details:      
 
Domain Number 7 Region: 500-638
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-32
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 8 Region: 1091-1216
Classification Level Classification E-value
Superfamily C-type lectin-like 9.28e-31
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 9 Region: 230-343
Classification Level Classification E-value
Superfamily C-type lectin-like 1.28e-30
Family C-type lectin domain 0.00073
Further Details:      
 
Domain Number 10 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-20
Family Fibronectin type II module 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006959   Gene: ENSOGAG00000007770   Transcript: ENSOGAT00000007776
Sequence length 1457
Comment pep:known_by_projection scaffold:OtoGar3:GL873538.1:15404299:15482871:-1 gene:ENSOGAG00000007770 transcript:ENSOGAT00000007776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSNTFSYVCVIYIFFFLTDTRQFLIYNEDHKRCVEAVSPSSVQTAVCNQDAESQKFRW
VSDSQVMSVAFKLCLGVPSKTDWVPVTLYACDLRSEFQKWECKNDTLFGIKGEDLYFNYG
NKQEKNIMLYKGSGLWSRWKIYGTTDDLCSRGYEAMYTLLGNANGATCAFPFKFENKWYA
DCTSAGRSDGWLWCGTTTDYDADKLFGYCPLKFEGSESLWNKDPLTSISYQINSKSALTW
HQARKSCQQQNAELLSITEVHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSGGSPFRY
LNWLPGSPSTEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNSTLNSFVIPSESDVPT
NCPSHWWPYAGYCYKIHREEKKIQRDALIACRKEGGDLASVHSIEEFDFIFSQLGYESSD
ELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVVMKGKDGYWADRACER
PLDYICKMKSQIQGSGIVEAEQGCRKGWKRYGYYCYLIGHTMSTFTEANETCKNEKAYLT
TIEDRYEQAFLTSLVGLRPEKYFWTGLSDIQNKGTFQWTIEEDVQFTHWNSDMPGRKAGC
VAMRTGMAGGLWDVLKCDEKTKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTSSKTSLCY
KLYAKGKHEKKTWFESRDFCKALGGDLATINNKEEQQVIWRLVTTSGSYHELFWLGLTYG
SPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPSMSWNDINCEHLNNWICQIK
KGQTPKPEPTPAPQDNPAVTEDGWVIYKDYQYYFSKEKDTMDNARAFCKRNFGDLVSIRS
ESEKKFLWKYVNKNDAQGAYFIGLLISLDKKFIWMDGSKVDYVSWATGEPNFANEDENCV
TMYSNSGFWNDINCGYPNAFICQRHNSSVNVTVMPTTPPVPSGCKEGWNFYNNKCFKIFG
FAAEERKKWQEARKACIGFGGNLATIQNEKEQAFLTYHMKDSTFNAWIGLNDVNSEHTFL
WTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGKSNEAGKWMDDVCDSKRGYMCQT
PPDPALPNSPATVPTDGFIKYGESSYSLMKFKVQWHEAEEYCRAHNSLIASILDPYSNAF
VWMQMQTLKEGVWIALNSNLTNNEYTWTDKWRVRYTNWAADEPKLKSACVYLDLDGFWKT
TPCNESFHFVCKKSDVVPATEPPQLPGRCPESQHTAWIPFHAHCYYIESSYTRNWGQASL
ECLRMGSTLVSIESAAESSFLSYRLEPLKSKTNFWTGLYRNVEGPGMWLWVNNNPLAFVN
WNTGDPSGEGNDCVAVQASSGFWNNIHCSSYKGYICKRPKIVDVEPTPTLITTKADSRKM
EPSKPSSNVAGVVVIVILLILTGAGLAAYFFYKKRRVHLPQEGAFENTLYFNSQSSSGIS
DTKDLMGNIEQNEHAII
Download sequence
Identical sequences H0WX08
ENSOGAP00000006959 ENSOGAP00000006959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]