SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006980 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006980
Domain Number 1 Region: 12-496
Classification Level Classification E-value
Superfamily ALDH-like 3.67e-184
Family ALDH-like 0.0000000000000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006980   Gene: ENSOGAG00000007796   Transcript: ENSOGAT00000007798
Sequence length 501
Comment pep:known_by_projection scaffold:OtoGar3:GL873530.1:10392645:10451354:-1 gene:ENSOGAG00000007796 transcript:ENSOGAT00000007798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWSGCIREKSYLLLSLVDRFTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADI
DKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMECLNGGKPFLQAFY
VDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKI
APALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHVGID
KIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQG
QCCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKILELIQS
GVAEGATLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIER
ANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGE
FGLREYSEVKTVTVKIPQKNS
Download sequence
Identical sequences H0WX28
ENSOGAP00000006980 ENSOGAP00000006980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]