SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007007 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007007
Domain Number 1 Region: 403-576,605-666
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.14e-45
Family Voltage-gated potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 670-855
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.43e-44
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 3 Region: 38-127
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.71e-21
Family Flavin-binding PAS domain 0.00000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007007   Gene: ENSOGAG00000007822   Transcript: ENSOGAT00000007829
Sequence length 1162
Comment pep:known_by_projection scaffold:OtoGar3:GL873572.1:7896091:7928433:1 gene:ENSOGAG00000007822 transcript:ENSOGAT00000007829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVM
QRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDG
AVIMFILNFEVVMEKDMLGSPAHDTNHRGPPTSWLAPGRAKTFRLKLPALLALTARDSSG
RASGASSVGAPGAVVVDVDLTPAAPSSESLALDEVTAMDNHVAGLGQAEERRALVGCGSP
LSNAPGPHPSPRVHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGALPPPP
PRHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREII
APKIKDRTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVI
YTAVFTPYSAAFLLKETEEGPPAPDCSYACQPLAVVDLIVDIMFIVDILINFRTTYVNAN
EEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKL
DRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSHIGWLHNLGDQIGKPYNS
SGLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNV
SAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKG
FPECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTAL
YFISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLL
EVLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSAELEGGFNRQRKRKLSFRRRTDKDT
EQPGEVSTLGPGWAGAGPTCRGRPGGSWGESPSSGPSSPESSEDEGPGRSSSPLRLVPFS
SPRPPGEPPGGEPLTEDCEKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPT
PSLLNIPLSSPGRRPRPRGDVESRLDALQRQLNRLETRLSADMATVLQLLQRQMTLVPPA
YSAVTTPGPCPASSSPLLPVSPIPTLTLDSLSQVSQFMACEELPLGVPELPQDGLARRLS
LPGQLGALTSQPLHRHGSDPGS
Download sequence
Identical sequences H0WX50
XP_003792105.1.62490 ENSOGAP00000007007 ENSOGAP00000007007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]