SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007110 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007110
Domain Number 1 Region: 18-135
Classification Level Classification E-value
Superfamily POZ domain 1.7e-27
Family BTB/POZ domain 0.0069
Further Details:      
 
Domain Number 2 Region: 309-398
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000017
Family Galactose-binding domain 0.043
Further Details:      
 
Domain Number 3 Region: 441-546
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000312
Family Galactose-binding domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007110   Gene: ENSOGAG00000007941   Transcript: ENSOGAT00000007945
Sequence length 612
Comment pep:known_by_projection scaffold:OtoGar3:GL873550.1:8962582:9355307:-1 gene:ENSOGAG00000007941 transcript:ENSOGAT00000007945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSHPLRPFAAVGEIDHVHILSEHIGALLIGEEYGDVTFVVEKKRFPAHRVILAARCHY
FRALLYGGMRESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKY
GFPELEDSTSEYLCTILNIQNVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLSSEGFLS
LSKTALLNIVLRDSFAAPEKDIFLALLNWCKHNSKENHAEIMQAVRLPLMSLTELLNVVR
PSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDT
QNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRLLLWDRDSRSYSYFIEVSMDELDW
IRVIDHSQYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKAFTIEKGL
IVPTENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIMVQLAQPYM
IGSIRLLLWDCDDRSYSYYVEISTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVG
THNTANEVFHCVHFECPEQQNSQKEENSEEPGTGDTSPAGQQLDPHALRAPGGNSLPSSP
GSNSRSPNRQHQ
Download sequence
Identical sequences H0WXD5
ENSOGAP00000007110 XP_012660291.1.62490 ENSOGAP00000007110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]