SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007113 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007113
Domain Number 1 Region: 61-180
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.04e-23
Family Glyoxalase I (lactoylglutathione lyase) 0.000000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007113   Gene: ENSOGAG00000007945   Transcript: ENSOGAT00000007948
Sequence length 186
Comment pep:known_by_projection scaffold:OtoGar3:GL873550.1:9432149:9463049:-1 gene:ENSOGAG00000007945 transcript:ENSOGAT00000007948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPQPASGGLTDEAALSCCSDADPSTKRFYFLLKSGLILLPKLLLNSWPQLLCLAILLL
EKLDFPTMKFSLYFLAYEDKNDIPKDKDEKIAWVFSRKATLELTHNWGTEDDEAQSYHNG
NSDPRGFGHIGIAVPEVHSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPN
KMRAIV
Download sequence
Identical sequences H0WXD7
ENSOGAP00000007113 ENSOGAP00000007113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]