SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007221 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007221
Domain Number 1 Region: 631-924
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.18e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000206
Further Details:      
 
Domain Number 2 Region: 928-1216
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.45e-73
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000164
Further Details:      
 
Domain Number 3 Region: 1-121
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.09e-36
Family Carbonic anhydrase 0.00025
Further Details:      
 
Domain Number 4 Region: 148-242
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000267
Family Fibronectin type III 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007221   Gene: ENSOGAG00000008069   Transcript: ENSOGAT00000008076
Sequence length 1251
Comment pep:known_by_projection scaffold:OtoGar3:GL873534.1:25356490:26091868:-1 gene:ENSOGAG00000008069 transcript:ENSOGAT00000008076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFVLRDLLPASLGSYYRYTGSLTTP
PCSEIVEWIIFRRPVPISYHQLEAFYSIFTTEQQDHVKSVEYLRNNFRPQQGLNGRVVSK
SAVRDAWNHDMNDFLENPLGTEASKVCSSPPIHMKVQPLNQTALQVSWSQPETIYHPPIM
NYMISYSWTKNEDEKEKTFTKDSDTDLKATISHVSPDSLYLFRVQAVCRNDMRSDFSQTM
LFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTWTSSGIPFSFVSMATGMGPS
SSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPTRLPTAAAAGKQAGRPVLTTTEAL
ASPGPDSDSAPTKDSEGTEEGGEKDEKSESEDGEREHEEEGEKDSEKKERSGTTRAAEEQ
NQTEPSPTASSPNRTTQDRGHQTIPGHEPDLTAVPTHQPGERRDADPDLDPDAITSTQVP
PTVTEEQYAGSDPRRPDMPSKKPRGDRFSEDSKFITVNPAAEKNTSGMISRPGPGRMEWI
IPLIVVSALTFVCLILLIAVLVYWRGCNKVKSKGFPRRFREVPSSGERGEKGSRHRKCFQ
TAHFYVEDSNSPRVVPNESIPIIPIPDDMEAIPVKQFGKHIGELYSNNQHGFSEDFEEVQ
RCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYN
KAKAYIATQGPLKSTFEDFWRMIWEQNTGIIIMITNLVEKGRRKCDQYWPTENSEEYGNI
IVTLKSTKVHACYTVRCFSVRNAKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYAL
PVLTFVRRSSAARTPEMGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIR
TQRNYLVQTEEQYIFIHDALLEAILGKETEVSSNQLHSYVNSILIPGVGGKTRLEKQFKL
VTQCNAKYVECFSAQKECNKEKNRNSSVVPSERARVGLAPLPGMKGTDYINASYIMLKGY
YRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEFVYWPSREESMNCEA
FTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLEVRHFQCPKWPNPDAPISSTFELIN
VIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVFQVAKMINLMRPGVF
TDIEQYQFVYKAMLSLVSTKENGNGPMTVDKNGAVLIADESDPAESMESLV
Download sequence
Identical sequences H0WXM8
ENSOGAP00000007221 ENSOGAP00000007221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]