SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007248 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007248
Domain Number 1 Region: 35-234
Classification Level Classification E-value
Superfamily Ribosomal protein S7 3.27e-50
Family Ribosomal protein S7 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007248   Gene: ENSOGAG00000008103   Transcript: ENSOGAT00000008105
Sequence length 242
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:6644434:6647635:-1 gene:ENSOGAG00000008103 transcript:ENSOGAT00000008105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASAVSFVRGWSCLALGLQRVVLRLPSVTQVRWSRYGPQYRDPKIDKEHFHKPVAELTE
EEKYDRELKKTQLIKAAPATKTSSVFEDPVISKFTNMMMKGGKKMMARSLMTKTLEAVKR
KQFEKYHAASAEEQAAIERNPYTIFHQALKNCEPVIGLVPILKGGHFYQVPVPLPDRRRR
FLAMKWMITECREKKHRRTLMPEKLSHELLEAFHNKGPVVKRKHDMHKMAEANRALAHYR
WW
Download sequence
Identical sequences H0WXQ0
ENSOGAP00000007248 ENSOGAP00000007248 XP_003786184.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]