SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007329 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007329
Domain Number 1 Region: 236-336
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.49e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000649
Further Details:      
 
Domain Number 2 Region: 88-140
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000249
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.039
Further Details:      
 
Domain Number 3 Region: 12-68
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000576
Family HLH, helix-loop-helix DNA-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007329   Gene: ENSOGAG00000008187   Transcript: ENSOGAT00000008192
Sequence length 664
Comment pep:known_by_projection scaffold:OtoGar3:GL873671.1:3260058:3285779:1 gene:ENSOGAG00000008187 transcript:ENSOGAT00000008192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLGNRSSTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLTIS
YLRMHRLCTAGEWNQVGEPLDACYLKALEGFVMVLTMEGDMAYLSENVSKHLGLSQLELI
GHSIFDFIHPCDQEELQDALTPQQSLSKKKPEAPTERCFSLRMKSTLTGRGRTLNLKAAT
WKVLHCSGHMRVYRPPMKTSPTGSPNSEPPLQCLVLICEAIPHPGSLEPPLGQGAFLSRH
SLDMKFTYCDERIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAVTGQYR
FLARSGGYLWTQTQATVVSGGRGPQSESIICVHFLISRVEETGMVLSLEQTERHSRRPIQ
WGASSQKDAPNSGDSLDASGPRILAFLHPPALSEAILAADPRRFCSPELRCLLAPILDGA
AVAATPSTPPATRRPQSPLPADLPDKLLVGMENAHRLSTSRKDFQAVETDLDMAQDVDAL
DLEMLAPYISMDDDFQLNSSEQLPRAYHRPPGAIPRPRARSFHGLSPPTPEPSILPRWGS
DPRLSCSSPSRGDPSASSPMAGARKRPLTQSSEDEAEGVELLGVRPPKRCPSSEPENFLL
FPLSLSFLLTGGPAPGSQQHPSTHLLDLNEPLGLGPSLLSLCPDEDTAQPGSHFQPGAGL
AQTH
Download sequence
Identical sequences H0WXX2
ENSOGAP00000007329 ENSOGAP00000007329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]