SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007479 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007479
Domain Number 1 Region: 3-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.54e-97
Family Carbonic anhydrase 0.00000000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007479   Gene: ENSOGAG00000008351   Transcript: ENSOGAT00000008354
Sequence length 260
Comment pep:known_by_projection scaffold:OtoGar3:GL873523.1:39491049:39499817:-1 gene:ENSOGAG00000008351 transcript:ENSOGAT00000008354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKEWGYADHNGPDHWPELFPFAKGNEQSPIELHTKDIQHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLSGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQHDGIAVIGIFLKIGREKGEFQIFLDALDKIKTKGKEAPFTHFDP
SCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPITVSSDQMAKLRSLLSSAENEPPVPL
VRNWRPPQPIKGRLVKASFK
Download sequence
Identical sequences H0WYA5
ENSOGAP00000007479 XP_003782557.1.62490 ENSOGAP00000007479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]