SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007493 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000007493
Domain Number - Region: 50-96
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.0432
Family 2-methylcitrate dehydratase PrpD 0.1
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007493   Gene: ENSOGAG00000008363   Transcript: ENSOGAT00000008368
Sequence length 257
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:20453352:20456962:1 gene:ENSOGAG00000008363 transcript:ENSOGAT00000008368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKIGWRRWMLQLLMQLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMG
AAVLCASFMSFGVKRRWFALGAALQLAISTYAAYIGGYVHYGDWLKVRMYSRTVAIIGGF
LVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVAYSLQHSKEDRLAYLNHLPGGELMI
QLFFVLYGVLALAFLSGYYVTLAAQILAVLLPPVMLLIDGNVAYWHNTRRVEFWNQMKLL
GESVGIFGAAVILATDG
Download sequence
Identical sequences H0WYB7
ENSOGAP00000007493 XP_003786334.1.62490 ENSOGAP00000007493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]