SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007683 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007683
Domain Number 1 Region: 14-130
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-28
Family Kringle modules 0.00083
Further Details:      
 
Domain Number 2 Region: 217-323
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-19
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007683   Gene: ENSOGAG00000008577   Transcript: ENSOGAT00000008580
Sequence length 461
Comment pep:known_by_projection scaffold:OtoGar3:GL873563.1:9392270:9395573:1 gene:ENSOGAG00000008577 transcript:ENSOGAT00000008580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTRVLQGFLLLFFPLLQPHEASAESLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPCL
FWNQTQQHSYSSASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHM
PGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGTESDLA
RGRLALATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNWTAPQGVVYSPDFPDEYGP
DRNCSWALGPPGAALELTFRLFELADQRDRLELRDATSGHLLRAFDGARPPPPGPLRLRA
AALLITFRSDSRGHAQGFALTYRGLPESIEDPASHKDSAQTTNAPPDGANVSCSPRPRAP
PVAMGAPVFSTVMSVSVLLLLFLSLLRLLRRRSCLLAPGKGAPALGPSEGPGKRWAVWYR
RPQEVALPCPPGDSQAEGPAPSYRPLSASSQSSLRSLISAL
Download sequence
Identical sequences H0WYS0
ENSOGAP00000007683 XP_003790858.1.62490 ENSOGAP00000007683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]