SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007726 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007726
Domain Number 1 Region: 67-201
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 1.05e-39
Family Band 7/SPFH domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000007726
Domain Number - Region: 208-323
Classification Level Classification E-value
Superfamily ALDH-like 0.036
Family ALDH-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007726   Gene: ENSOGAG00000008621   Transcript: ENSOGAT00000008624
Sequence length 356
Comment pep:known_by_projection scaffold:OtoGar3:GL873691.1:1259906:1263792:1 gene:ENSOGAG00000008621 transcript:ENSOGAT00000008624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARAARGTGALLLRGSVQAFGRSPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILE
PGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVE
DPEYAVTQLAQTTMRSELGKLSLDRVFRERESLNASIVDAINQAADCWGIRCLRYEIKDI
HVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQA
AGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTILLPS
NPGDVTGMVAQAMGVYGALTKAPVPGTQDSVTSESSRDVQGTDTSLDEELDRVKLS
Download sequence
Identical sequences H0WYV3
ENSOGAP00000007726 ENSOGAP00000007726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]