SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007783 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007783
Domain Number 1 Region: 210-348
Classification Level Classification E-value
Superfamily C-type lectin-like 7.42e-34
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 2 Region: 350-487
Classification Level Classification E-value
Superfamily C-type lectin-like 1.36e-32
Family C-type lectin domain 0.00064
Further Details:      
 
Domain Number 3 Region: 1367-1514
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-28
Family C-type lectin domain 0.0033
Further Details:      
 
Domain Number 4 Region: 948-1093
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-28
Family C-type lectin domain 0.0028
Further Details:      
 
Domain Number 5 Region: 1109-1255
Classification Level Classification E-value
Superfamily C-type lectin-like 6.75e-27
Family C-type lectin domain 0.00099
Further Details:      
 
Domain Number 6 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.45e-26
Family Cysteine rich domain 0.0066
Further Details:      
 
Domain Number 7 Region: 1528-1661
Classification Level Classification E-value
Superfamily C-type lectin-like 1.12e-23
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 8 Region: 635-792
Classification Level Classification E-value
Superfamily C-type lectin-like 1.48e-23
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 9 Region: 501-625
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-19
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 10 Region: 1236-1358
Classification Level Classification E-value
Superfamily C-type lectin-like 7.87e-19
Family C-type lectin domain 0.0039
Further Details:      
 
Domain Number 11 Region: 817-931
Classification Level Classification E-value
Superfamily C-type lectin-like 4.39e-16
Family C-type lectin domain 0.026
Further Details:      
 
Domain Number 12 Region: 154-210
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000217
Family Fibronectin type II module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007783   Gene: ENSOGAG00000008678   Transcript: ENSOGAT00000008686
Sequence length 1721
Comment pep:novel scaffold:OtoGar3:GL873617.1:6950722:7057065:-1 gene:ENSOGAG00000008678 transcript:ENSOGAT00000008686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQRWATPRRAAGLLLLLLPCFGLAQPSGRSGNDPFTIVNANTSKCIKPMSNWIVAMDCV
DTEDMLWKWVSQHRLFHLHSQKCLGLDITKPEDSLGLFSCDSSVMLWWKCDHHSVYGAAQ
YGLALQSGHAIATTDASDVWKKGGSEESLCDQPYREIYTRDGNSYGRPCEFPFLVDGTWH
HECILDEDHSGPWCATTLNYQYDQKWGICLKPENGCKDNWEKNEQTGSCYQFNTQAALTW
KEAYVSCHNQGADLVSISNAAELTYLKEKEGIARLFWIGLNQLYSARGWEWSDHKPLNFL
NWDPDRPSAPTIGGSSCARMDAESGLWQSFSCEARLPYVCRKPLNNTVELTDVWTYSDTH
CDSGWLPNNGFCYLLVNKSDSWDEAHKKCKASGSDLISIHSLADVEVAVTKLHNGDAKEE
IWIGLKNVNVPTLFQWSDGTEVTLTYWDENEPEVPYNQTPNCVSYLGELGQWKVQSCEEK
LKYVCKKKGEKMNDTRSDKMCPPEEGWERHGEACYKIYKDEVSFGTNCNLTITSRFEQEY
LNNMMRKYDKSLRKHFWTGLRDVDSRGEYSWSTVGGIKQAVTFSNWKFLEPASRGGCVAM
STGKSLGKWEVKDCRSFRALSICKKISGPLKPEEAAPKPDDLCPEGWQSLPSSLSCFKVF
HVERIVRKRNWEEAERFCQALGAHLLSFSHVDEIMKFLHSIVDQFSGQRWLWIGLNKRSP
DLQGSWQWSDHTPVSTITMADEFQQDYDIRDCAAVKVVHRPWRRGWFFFDDRETIFFRPF
ACDTKLEWVCQIPKGHTPKTPDWYNPERAGIHGPPVIIEGSEYWFVADPHLNYEEANLYC
ASNHSFLATITSFARLRAIRKKIANISVDVQKWWVRTSEQPIDHRFMYSHLSHYFPMGAG
EECLYMSAKTWLIDLSKPADCSSKFPFICEKYNVSSLEKYSPDSAAKVQCSGDWIPFQNK
CFLKVKSTSLKFSQASELCHSYGGTLPSILSQNEQDFITSLLPGMETTLWIGLRWTAYEK
ISKWTDNRELTFSNFHPLLVGRRLRIPGNLFEEESQYHCAILLNLQKSPFTGTWNFTSCG
EHHPVALCQKYAEIKGTETLQNTSETVKYLNNLYKIIPKTLTWHAAQRECLQSNMRLVSI
TDPYQQAFLAVQAVLRNSSLWIGLSSQDDELNFGWSDGKHLHFSRWAENSEQLEDCVLLD
TDGFWKTADCGDDQPGAICYYPGNETEQEVRPVARVKCPSPVLNTPWIPFQNYCYNFMIT
NNRHMAMTQDEVHSKCQKLHPKSHILSIRDENENNFVLEQLLYFSYMASWVMLGITYENN
SLTWFDKTRLSYTHWREGRPTIKNGKFLAGLGTDGFWDIHTFNIIDEVLYFHQHSILACK
IEMVDYKEEYNSTLPQFIPYEDGIYNVIQKKVTWYEALNTCSQNGGYLASVHNPNGQLFL
EDVVRRDGFPLWVGLSSHDGSESSFEWSDGSTFDYIPWKGQKSPGNCVVLDPKGIWKHEK
CNSVKDGAICYKPLKSKELSPYAYSSRCPASKGNGSRWIQYGDHCYMSDQQLHSFSEAKQ
LCPQFDHSANIISIKDEAENKFVSRLMRENNNITMRVWLGFSQNSADQSWSWLDGSEGKF
VKWENKSKSGNGKCSILIASNETWKKVECAHGFGRVVCKVPLGPDYRGIVITFAVLSVLA
LISGLIWFFFQKNRFHWARFSSVRYAQGMNENEIMLPSFHD
Download sequence
Identical sequences H0WZ04
XP_003796022.1.62490 ENSOGAP00000007783 ENSOGAP00000007783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]