SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007796 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007796
Domain Number 1 Region: 375-505
Classification Level Classification E-value
Superfamily C-type lectin-like 5.74e-34
Family C-type lectin domain 0.00077
Further Details:      
 
Domain Number 2 Region: 229-363
Classification Level Classification E-value
Superfamily C-type lectin-like 1.73e-29
Family C-type lectin domain 0.00081
Further Details:      
 
Domain Number 3 Region: 809-940
Classification Level Classification E-value
Superfamily C-type lectin-like 7e-29
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 4 Region: 1118-1237
Classification Level Classification E-value
Superfamily C-type lectin-like 6.24e-28
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 5 Region: 660-801
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-27
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 6 Region: 955-1101
Classification Level Classification E-value
Superfamily C-type lectin-like 3.78e-27
Family C-type lectin domain 0.00063
Further Details:      
 
Domain Number 7 Region: 1242-1367
Classification Level Classification E-value
Superfamily C-type lectin-like 1.3e-24
Family C-type lectin domain 0.0046
Further Details:      
 
Domain Number 8 Region: 164-221
Classification Level Classification E-value
Superfamily Kringle-like 1.03e-21
Family Fibronectin type II module 0.00085
Further Details:      
 
Domain Number 9 Region: 510-647
Classification Level Classification E-value
Superfamily C-type lectin-like 1.34e-21
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 10 Region: 38-162
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.27e-20
Family Cysteine rich domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007796   Gene: ENSOGAG00000008692   Transcript: ENSOGAT00000008701
Sequence length 1466
Comment pep:known_by_projection scaffold:OtoGar3:GL873617.1:7093442:7219487:-1 gene:ENSOGAG00000008692 transcript:ENSOGAT00000008701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLPLLLLLLLLLGAPRGCAEGAGATPTPEWALEWQGKGIFIIQSESLKKCIQAGKSVLT
LESCEQPDKYMLWKWVSNHHLYNIGGSGCLGLNLSNPEQPLSLYECDSTHVSLGWHCHRK
MITGPLRYMVQVKQDNTVVASWTYTHKWISYLSGSGDICEYLHKDLYTIKGNAHGMPCVF
PFQYNHQWHHACTREGRDDDLLWCATTSRYERDEKWGFCPDPTSAEVSCDAVWEKSLDSH
ICYQFNLLSSLSWSEAHSSCHMQGGALLSIADETEENFIRKHMSGDTVEVWIGLNQPDDK
AGWQWSDGTPLSYLNWNPEINFEPLVEYPCGTFNSFMTSAWRSRDCKSTLPYICKKYLNH
TDHEIVEEKDAWKYHATHCEPGWNPYNRNCYKLQKEEKTWNEALRSCQSDNSTLIDTISL
AEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNGSSVIFTNWNTHEPHIFPNRSQLCV
SAEHSEGHWKVKNCEETLFYICEKTGRVPSDAETGCQEGWERHGRFCYKIDTVLRSFGHA
SSGYYCPPALVTIANRFEQAFITSLISGVVKMKDSYFWIALQDQNDTGEYTWKTAGQTSE
QVRYTHWNARQPSYSGGCVAMRGRYPLGRWEVKDCRHFKAMSVCKQPVETQEKTEHEERW
PFHPCYLDWESEPGLASCFKVFHSEKVLGKRTWREAEAFCEEFGAHLASFAHIEEENFVN
DLLHSKFNWTEERQFWIGFNKRNPLSAGSWEWSDGTPVVSSFLDNIYLEEDARNCAVFKA
NKTLLPLHCDSKREWICKIPRDVRPKIPSWYQYDAPWLFYQDSEYLFHTYASEWSAFEFV
CGWLQGDLLTIHSAHEQEFIYSKIKMLSKYGANWWIGLQEERANDEFRWRDGTPVIYQNW
DKGKEISGNNQSQRCGFISSITGLWGSEECSVSMPSICKRKKIWVIEKENNTPKQHGTCP
KGWLYFNYKCLLVNIPKDPSDQKNWPRARDFCVEAGGTLVAIESEVEQAFITMNLFGQTT
NVWIGLQNSNYEKWLNGKPVAYSNWSPVDVINIPSYNTTEVQKHIPLCVLLSSNPNFHFT
GKWYFEDCGKEGYGFVCEKMQDASGHDVNTSDMYPVPNTLEYGNRTYKIIHANMTWYAAI
KTCLVHGADLVSIADQYHQSFLTVVLNRLGHAHWIGLFTTDNGLNFDWSDGTKSSFTFWK
DEASSFLGDCVYADTSGRWHSTACESFLQGAICQVPTETRQFEHPELCSETSIPWIKFKR
NCYSFSTVLDSTSFEAAYEFCKREGSNLLTIKDETENAFLLQELFAFGSSVQMVWLNAQF
DSNNETIKWFDGTPTDQSNWGIREPARDHFKPHQCVALSIPEGVWQQITKLKEKPHFVFF
NLILDIHTTKEHPGKGPNHSVVPLAVALILIIMLAIFTLSFYIYKQNSGFCRRLAGFQSP
YYPTTNFSTVHLEENILISDLEKNDQ
Download sequence
Identical sequences H0WZ14
ENSOGAP00000007796 ENSOGAP00000007796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]