SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007857 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007857
Domain Number 1 Region: 114-158
Classification Level Classification E-value
Superfamily LysM domain 0.0000000183
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007857   Gene: ENSOGAG00000008760   Transcript: ENSOGAT00000008765
Sequence length 932
Comment pep:known_by_projection scaffold:OtoGar3:GL873521.1:20713936:20794901:1 gene:ENSOGAG00000008760 transcript:ENSOGAT00000008765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WGHKIEKKPRVSTLLPRLKKKKQAKQNAETASAIAARTHTGKEDVNTVILEQDKRNNAVE
QEYVTDEKKKRKTNQLKEIRRTELKRYYSIDDNQNKTHDKKEKKMVLQKPHGTMEYTAGS
QDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDANYPSSTLRLSSSSPGATVSP
SSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVM
IVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSPGEWE
DLASEKDINPFSKFKSINKERRQQSAERTVTLDSNSTRPLEKSTEHTHMKPSGSSVSEKL
RKLESSKETARDSPTVTKLSKGPSDTHSAFESSAKENSLLGEDDDFVDLEELPSQPDHGM
DKRDPSKECLFVNSEERKKAESQRINSAREKQVQLTLNFSEAGNDAELKGALDLETCEKQ
DMMPEVDKQSGSPDSQVENTLNIHEDLDKVKLIEYYLHKNKEGSQLSENLQKAELSDGKS
IEPVGIDITLSSSFPQAGDPSSEGSKEPDKTWVKEIEPLPMKMDPSTEESMIKEPLDSSL
EPTLDNSCEDTQTDNKSEIQLWLLKRIQVPIEDMLPSKEEKSKTPPMFLCIKVGKPMRKS
FATQTTAMVQQYGKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKDAKEQGFVVVEKE
ELNMIDNFFSEPTTKSWEIITVEEAKRRKSTCSYCEEEEEEALPVLQPHSALLENMHIEQ
LARRLPARVQGYPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIKDMDNQIFGAYATHP
FKFSDHYYGTGETFLYTFSPNFKVFKWSGENSYFINGDISSLELGGGGGRFGLWLDADLY
HGRSNSCSTFNNDILSKKEDFIVQDLEVWTFE
Download sequence
Identical sequences H0WZ63
ENSOGAP00000007857 ENSOGAP00000007857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]