SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007938 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007938
Domain Number 1 Region: 10-367
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 2.25e-90
Family Extradiol dioxygenases 0.0000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007938   Gene: ENSOGAG00000008855   Transcript: ENSOGAT00000008857
Sequence length 390
Comment pep:known_by_projection scaffold:OtoGar3:GL873618.1:2291779:2306964:-1 gene:ENSOGAG00000008855 transcript:ENSOGAT00000008857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTYSDKGAKPERGRFLHFHSVTFWVGNAKQAASFYCSKMGFEPLAYRGLETGSREVVSHV
IKQGKIVFVLSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKAREQGAKIVREP
WVEQDKFGKVKFAVLQTYGDTTHTLVEKMNYTGRFLPGFEAPTFKDPLLSKLPKCSLEII
DHIVGNQPDQEMVPASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPIN
EPAPGRKKSQIQEYVDYNGGAGVQHIALKTEDIIMAIRHLRERGMEFLAVPSTYYRQLRE
NLKTAKIQVKESIDVLEELKILVDYDEKGYLLQIFTKPMQDRPTLFLEVIQRRNHQGFGA
GNFNSLFKAFEEEQDLRGNLTDLEPNGVVS
Download sequence
Identical sequences H0WZC9
ENSOGAP00000007938 ENSOGAP00000007938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]