SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008006 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008006
Domain Number 1 Region: 1346-1484
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.1e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000151
Further Details:      
 
Domain Number 2 Region: 235-335
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000038
Family Calponin-homology domain, CH-domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008006   Gene: ENSOGAG00000008928   Transcript: ENSOGAT00000008933
Sequence length 1490
Comment pep:known_by_projection scaffold:OtoGar3:GL873574.1:8381270:8500593:-1 gene:ENSOGAG00000008928 transcript:ENSOGAT00000008933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAADPREMRKTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTENVPEELREPFYTD
QYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQALAQKGLYVTDQEKL
VTERDLHKKPIQMSAHLAMMDTLMMAYTVEMVSIEKVIACAQQYSAFFQATDLPYDIEDA
VMYWINKVNEHLKDIMEQEQKLKEHHTVEAPGGQKSPSKWFWKLVPARYRKEQTLLKQLP
CIPLVENLLKDGTDGCALAALIHFYCPGVVRLEDICLKETMSLADSLYNLQLIQEFCQEY
LNQCCHFTLEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRVVCPQGAEPVKDMPS
IPVLNTAKRNVRDSSCSSDFISSGEGATFAQSHHPLPSRYSRPQAHSSTSGGIRRSSSMS
YVDGFIGTWPKEKRSSVHGVSFDISFDKEDSVQRSTLNRGITRSISNEGLTLNNNRVSKH
IRKNLSFKPINGEEEAESIEEELNIDSHSDLKSYVPLNTNELNANENIHYKLPNGALQNR
VLLDEFGNQIETPSIEEALQIIHDTDKSPHTPQPDQIANGFFLHSQEMSILNSNTKLNQS
SPDNITDTKGALSPITDNTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKFL
QDYDIRTSNPREALSPCPSTISTKSQPGSSASSSSGVKMTSFAEQKFRKLNHTDGKSSGS
SSQKTTPEGSELNIPHVVAWAQIPEETGIPQGRDTTQLLASEMVHLRMKLEEKRRAIEAQ
KKKMEAAFTKQRQKMGRTAFLTVVKKKGDGISPLREEAAGAEDEKVFTDRAKEKESQKPD
GQRSKSLADIKESMENSQSKWLKSPTTPVEPEKQWNLASPSEETLNEGEILEYTKSIEKL
NSSLHFLQQEMQRLSLQQEMLMQMREQQSWVISPPQPSPQKQIRELKPSRQPGPSAITPF
LSDSPRPTHPSPQSSNRKSTSFSVKNQRTPRPNELKITPLNRTLTPPRSVDSLPRLRRFS
PSQVPIQTRSFVCFGDDGEPQLKESKPKEEVKKEELESKGPSEQRGHNPEEKEIKPFEST
VSEVLSQPVTETVCLTANEDQLNQPTEPPPKLIFPPTTPKSVNLIEVSLSDLKPPEKADV
SVEKYDGESDKEQFDDDQKVCCGFFFKDDQKAENDMAMKRAALLEKRLRREKETQLRKQQ
LEAEMEHKKEETRRKTEEERQKKEDERARREFIRQEYMRRKQLKLMEEMDTVIKPRPQAA
KQKKQRPKSIHRDHIESPKTPIKGPPVSSLSLASLNTGDNESVHSGKRTPRSESVEGFLS
PSRCGSRNGEKDWENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVN
EGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIE
GLYKYNSDRKQFSHIPAKTLSASVDAITIHSHLWQTKRPVTPKKLLPTKA
Download sequence
Identical sequences H0WZI6
ENSOGAP00000008006 XP_003792345.1.62490 ENSOGAP00000008006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]