SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008011 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008011
Domain Number 1 Region: 76-217
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.45e-23
Family Toll/Interleukin receptor TIR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008011   Gene: ENSOGAG00000008935   Transcript: ENSOGAT00000008938
Sequence length 220
Comment pep:known_by_projection scaffold:OtoGar3:GL873616.1:450415:453265:1 gene:ENSOGAG00000008935 transcript:ENSOGAT00000008938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSTSLPAPRSRSRKPLSKMTDWLRQALSRKPERTSESAESSPGATSRPASQDGLPAKG
ISSVGSPGTPLTPGYGSNGRWGKDYDVCVCHSEEDLGAAQALVSHLEGSAASLRCFLQLR
DAAPGGAIASELCQALSRSHCRVLLITPGFLRDPWCRYQMLQALAEAPGAEGRTIPLLSG
LARADYPPELRFMYYVDGRGPDGGFHQVQEAVLRYLKTLP
Download sequence
Identical sequences H0WZJ1
ENSOGAP00000008011 XP_003795976.2.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]