SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008132 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008132
Domain Number 1 Region: 59-165,208-389
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0000000000196
Family Tricorn protease domain 2 0.06
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000008132
Domain Number - Region: 978-1066
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 0.0222
Family ADP-ribosylglycohydrolase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008132   Gene: ENSOGAG00000009065   Transcript: ENSOGAT00000009072
Sequence length 1342
Comment pep:known_by_projection scaffold:OtoGar3:GL873533.1:12543388:12616284:-1 gene:ENSOGAG00000009065 transcript:ENSOGAT00000009072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FYFSLGNLLIMRNLKLLRTLEFRDIQAPGRPQCFCLRSEQSTVLIGSEHGLIEVDPIRRE
VSDGWRMLHLDFLPQDNLFYIIGFKNFHMPLKVCIDFITGVIVLFIFSLSQLECVGSVAS
GISVMSWSPDQELVLLATGQQTLIMMTKDFEPIMEQQIHQDDFGESKFITVGWGKKETQF
HGSEGRQAAFQVQMHESALPWDDHRPQVTWRGDGQFFAVSVVCPETGARKVRVWNREFAL
QSTSEPVAGLGPALAWKPSGSLIASTQDKPNQQDVVFFEKNGLLHGHFTLPFLKDEVKVN
NLLWNADSSVLAVWLEDLQREENSTLKTYVQLWTVGNYHWYLKQSLPFSTCGKSKIVSLM
WDLVTPYRLHVLCQGWHYLCYDWHWTTDRSLGDNSSDLANVAVIDGKKVLVTVFRQTVVP
PPMCTYQLLLPHPVNQVTFSTYPGKSNDLAVMDASNQISIYKCGDSPSVDPTVKLGAVGG
NGFKVSLRTPHLEKRYKIQFENSEDQEVNPLKLILLTWIAEDIFLAISHSQSGPQSVIHH
LSVAPSEMDEEQGRLNVSSSVAVNGIIISLCCNSKTKSVALQLADGQILKYLWESPSLAI
KPWKNPGGFPLQFPCACTQTELAMIGGEECVLGLTDRCRFFINDTEIASNITSFAVYDEF
LLLTTHSHTCQCFCLRDASFKLLQAGLSSSHVSNGEIMRKVERGSRIVTVVPQDTKLILQ
MPRGNLEVVHHRALVLAQIRKWLDRLMFKEAFECMRKLRINLNLIYDHNPKVFLENVETF
IRQIESVNYINLFFTELKEEDVTKTMYPPPVTSSVQLSREPHERKLDLICDAMRAAMENI
NPHKYCLSILTSHIKKTTPELEIVLQKVHELQGNTASVPDSVSAEEALKYLLLLVDVNEL
YDHSLGTYDFDLVVMVAEKSQKDPKEYLPFLNTLKKMETNYQRFTIDKYLKRYEKAIGHL
SRCGPEYFPECLNLIKDQNLYNEALKLYPPNSQQYKDIGVAYGEHLMQECMYEPAGLMFA
RCGAHEKALSAFLTCGSWKQALCVASQLNLTTDQLAGLARTLAGKLVEKRKHVDAAIVLE
QYAQDYEEAVLLLLEGAAWEEALRLVYKYNRLDIIETNIKPSILEAQKNYMVFLDSQTTT
FSRHKKRLLVVRELKEQAQQVNLDDEVLHRQESDLFSETSSIVSGSEMSGKYSQSNSRIS
ARSSKNRRKAERKKHSLKEGSPLEDLALLEALNEVVQNTEKLKDEVYHTLKVLFLFEFDE
QGRELQKAFEDALQLMEKSLPEIWTPTDQQNSATPVLGPNSTANSIMASYQQQKTSVPVL
DSELFIPPKIDTRTQWKLSLLE
Download sequence
Identical sequences H0WZU0
ENSOGAP00000008132 ENSOGAP00000008132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]