SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008267 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008267
Domain Number 1 Region: 85-256
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.69e-48
Family G proteins 0.0000000745
Further Details:      
 
Domain Number 2 Region: 4-89
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 5.76e-30
Family Transducin (alpha subunit), insertion domain 0.000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008267   Gene: ENSOGAG00000009228   Transcript: ENSOGAT00000009233
Sequence length 262
Comment pep:known_by_projection scaffold:OtoGar3:GL873525.1:35560697:35570443:-1 gene:ENSOGAG00000009228 transcript:ENSOGAT00000009233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRRYSHEQNEENAQMIREVEVDKVSMLSRDQAEAIKQLWQDPGIQECYDRRREYQLSDST
KYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLEDIIFRMVDVGGQRSERRKWI
HCFESVTSIIFLVALSEYDQVLAECNNENRMEESKALFKTIITYPWFLNSSVILFLNKKD
LLEEKIMYSHLISYFPEYTGPKQDVKAARDFILKLYQDQNPDKEKVIYSHFTCATDTENI
RFVFAAVKDTILQLNLREFNLV
Download sequence
Identical sequences H0X051
ENSOGAP00000008267 ENSOGAP00000008267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]