SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008372 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008372
Domain Number 1 Region: 12-210
Classification Level Classification E-value
Superfamily ITPase-like 1.18e-53
Family Maf-like 0.0000153
Further Details:      
 
Domain Number 2 Region: 421-611
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.13e-37
Family Plant O-methyltransferase, C-terminal domain 0.0027
Further Details:      
 
Domain Number 3 Region: 289-354
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000151
Family TrmB-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008372   Gene: ENSOGAG00000009349   Transcript: ENSOGAT00000009350
Sequence length 623
Comment pep:known_by_projection scaffold:OtoGar3:GL873584.1:1096493:1117591:-1 gene:ENSOGAG00000009349 transcript:ENSOGAT00000009350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLCPVLGKLLHKHVVLASASPRRREILSNAGLRFEVVPSKFKEKLNKASFPTPYAYAVE
TAKQKALEVASRLHQKDLRTPDVVIGADTIVAVSGLILEKPVDKQDAYRMLSRLNGKEHS
VFTGVAIVHCYSKEGQLDTEVSEFYEETSVKFSELSEELLWEYIHSGEPMDKAGGYGIQA
LGGMLVEYVRGDFLNVVGFPLNHFCKKLVELYYPPRQGDLQRARQDSIPPVDTFENPRDV
DGAGCMPVQRTAGSSKDRAEAGTDHQAGGTLDTDCNRMVGPLPPFPASLLELVDGFKVSK
ALFTACRLKVFDVLKGEVPQKAEDIASIVDISVCGAKRLLDVCATLGLLERSEREMLNAS
IGTHKRMIEMRGDGQIDENTVLEHKVYVLCSTSSFRRRGGQKTPHIQLPMEPFPLFQNTS
LQTREDKLQFVGAMHSLGKLTTRQVVTAFDLSPFASACDLGGCTGALARELSRQYPRLKV
TVVDLPDIIEHVFCFQRDGPEMARVRFQAGDFFRDSLPKADLYILSRVLHDWPDDRVQGL
LSRVSSSCRPGAGLLLVEAIMDSEERKPRASLMWSLNSLLQTGGRDRCVADYRALLEQHG
FGDVQEAPAGPGLTALLGTRVGQ
Download sequence
Identical sequences H0X0D5
ENSOGAP00000008372 ENSOGAP00000008372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]