SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008386 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008386
Domain Number 1 Region: 187-483
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.45e-41
Family NadC C-terminal domain-like 0.044
Further Details:      
 
Domain Number 2 Region: 6-73,113-152
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.0000777
Family NadC N-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008386   Gene: ENSOGAG00000009361   Transcript: ENSOGAT00000009364
Sequence length 491
Comment pep:novel scaffold:OtoGar3:GL873524.1:2505043:2542249:1 gene:ENSOGAG00000009361 transcript:ENSOGAT00000009364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAAEDEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFY
GLQYILNKYLKGKVVTKEKIQEAKEVYREHFQDDVFNEKGWNYILEKYDGHLPIEIKAVP
EGSVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETS
GNLNGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGIALIKKYYGMKDPVPGY
SIPAAEHSTITAWGKDHEKDAFDHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIV
SRSTEAPLIIRPDSGNPLDTVLKVLDILGKKFPITENSRGYKLLPPYLRVIQGDGVDINT
LQEIVEGMKQKKWSIENVAFGSGGALLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVAD
PNKRSKKGRLSLHRTPAGNFVTLEEGKGDLEEYGQDLLHTVFKNGKVTKTYSFDEVRKNA
QLSSELDAAPH
Download sequence
Identical sequences H0X0E8
ENSOGAP00000008386 XP_012667573.1.62490 ENSOGAP00000008386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]