SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008415 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008415
Domain Number 1 Region: 13-123
Classification Level Classification E-value
Superfamily POZ domain 3.06e-24
Family BTB/POZ domain 0.0011
Further Details:      
 
Domain Number 2 Region: 1010-1062
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.81e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 1049-1105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000481
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 483-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000557
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 342-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000112
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000008415
Domain Number - Region: 457-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000261
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number - Region: 1124-1154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00654
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008415   Gene: ENSOGAG00000009394   Transcript: ENSOGAT00000009398
Sequence length 1196
Comment pep:known_by_projection scaffold:OtoGar3:GL873551.1:11151505:11155095:1 gene:ENSOGAG00000009394 transcript:ENSOGAT00000009398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMTVMSLTRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNVLAASSLYFK
NIFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVKRQETVTDLAAAGKKLGISFL
EDLTDRNFSNSPGPYVFCITEKGVVKEEKNEKRHEEPAITNGPRITNAFSIIETENSNNM
FSPLDLRASFKKVSDSMRTASLCLERTDVCHEAEPVRTLAEHSYAVSSVAEAYKSQPACE
HDSNSPGQTGKENCEALAAKPKTCRKPKTLSIPQDSDSTTENAPLPPVTNLEVNQEKSPQ
PATVLPHSKSPSNEGDVHFSKEDGSQPSEVPGPPAAEVPPLVYNCSSCSKSFDSSTLLSA
HMQLHKPTQEPLVCKYCNKQFTTLNRLDRHEQICMRSSHMPVPGENQRFLENYPTIGQNS
ASFTGPEALLSENRIGEFSSTGSTLPDTDHMVEFVNGQMLYSCVVCKRSYVTLSSLRRHA
NVHSWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCIFCLETFMTYYILKNHQKSFH
AIDHRLSISKKTANGGLKPSVYPYKLYRLLPMKCKRAPYKSYRNSSYENARESSQMNESV
PGTYIQNPHSSELPTLNFQKSGNTVTNSPAIPLETSACQDTPTSAKVQNAEGTKWGEETL
KTDLDGNFYSTEVSVSSTENALGSGLKVGKAPALPLSKGSEKPASVISYSGSAPSVIVHS
SQFSSVITHSNAVASTTGSNHRALPDPAASQSLKDDSKPEPDKVGRFMSRPKSIKEKKKM
VPHNRGETTEESKYIADPGGSLGKVTNTVKETSKIETYIAKPALPGTSTNSNVAPLCQIT
VKIGNEAIVKRHILGSKLFYKRGRRPKCHMQEETLPQKSDPEPSGDSPLDLCQSECVEMN
EVFDDASDQDSTDKPWRPYYNYKPKKKSRQLRKMRKGSWKKEHGNRSPSSKCRYPAELDC
AVEKAPEDKAFEEEEEENKEMPKLQCELCDGDKASGGGNQGKPHRHLASKPYVCELCAKQ
FQSPSTLKMHMRCHTGEKPYECKTCGRCFSVQGNLQKHERIHLGLKEFICQYCNKAFTLN
ETLKIHERIHTGEKRYHCQFCFQSFLYLSTKRNHEQRHIREHNGKGYACFQCPKICKTAA
ALGMHQKKHLFKSPSQQERLGYMCHGNSSPLENPHFIDSEDSDQKDNIQHIAENVL
Download sequence
Identical sequences H0X0H6
ENSOGAP00000008415 ENSOGAP00000008415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]