SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008616 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008616
Domain Number 1 Region: 318-500
Classification Level Classification E-value
Superfamily Kelch motif 1.19e-52
Family Kelch motif 0.0000192
Further Details:      
 
Domain Number 2 Region: 461-600
Classification Level Classification E-value
Superfamily Kelch motif 5.1e-39
Family Kelch motif 0.00012
Further Details:      
 
Domain Number 3 Region: 44-162
Classification Level Classification E-value
Superfamily POZ domain 1.31e-31
Family BTB/POZ domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008616   Gene: ENSOGAG00000009630   Transcript: ENSOGAT00000009633
Sequence length 621
Comment pep:known_by_projection scaffold:OtoGar3:GL873558.1:3110247:3136807:1 gene:ENSOGAG00000009630 transcript:ENSOGAT00000009633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDSVNGKQARSHFTKGKRQQQQQQQLKNRSSVSDGGGEDSFIFEANEAWRDFHGSLLR
FYENGELCDVTLKVGSKLISCHKLVLACVIPYFRAMFLSEMAEAKQTLIEIRDFDGDAIE
DLVKFVYSSRLTLTVDNVQPLLYAACILQVELVAKACCEYMKLHFHPSNCLAVRAFAESH
NRIDLMDMADQYACEHFTEVVECEDFVSVSPQHLHKLLSSSDLNIENEKQVYSAAIKWLL
ANPQHHSKWLDETLAQVRLPLLPVDFLMGVVAKEQIVKQNLKCRDLLDEARNYHLHLSSR
AVPDFEYSVRTTPRKHTAGVLFCVGGRGGSGDPFRSIECYSINKNSWFFGPEMNSRRRHV
GVISVEGKVYAVGGHDGNEHLGSMEMFDPLTNKWMMKASMNTKRRGIALASLGGPIYAIG
GLDDNTCFNDVERYDIESDQWSAVAPMNTPRGGVGSVALVNHVYAVGGNDGVASLSSVER
YDPHLDKWIEVKEMGQRRAGNGVSELHGCLYVVGGFDDNSPLSSVERYDPRSNKWDYVAS
LTTPRGGVGIATVMGKIFAVGGHNGNAYLNTVEAFDPVLNRWELVGSVSHCRAGAGVAVC
ACLTSQIRDVGHGSNNVVDCM
Download sequence
Identical sequences H0X0Y7
ENSOGAP00000008616 XP_003790073.1.62490 ENSOGAP00000008616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]