SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008621 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008621
Domain Number 1 Region: 102-226
Classification Level Classification E-value
Superfamily vWA-like 1.07e-39
Family Integrin A (or I) domain 0.0000347
Further Details:      
 
Domain Number 2 Region: 589-666
Classification Level Classification E-value
Superfamily Integrin beta tail domain 9.29e-17
Family Integrin beta tail domain 0.0039
Further Details:      
 
Domain Number 3 Region: 328-420
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000000518
Family Integrin domains 0.0018
Further Details:      
 
Domain Number 4 Region: 3-61
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000994
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 5 Region: 503-543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000121
Family Integrin beta EGF-like domains 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000008621
Domain Number - Region: 547-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000103
Family Integrin beta EGF-like domains 0.015
Further Details:      
 
Domain Number - Region: 425-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family Integrin beta EGF-like domains 0.038
Further Details:      
 
Domain Number - Region: 468-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00977
Family Integrin beta EGF-like domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008621   Gene: ENSOGAG00000009633   Transcript: ENSOGAT00000009638
Sequence length 737
Comment pep:known_by_projection scaffold:OtoGar3:GL873647.1:4243225:4266987:-1 gene:ENSOGAG00000009633 transcript:ENSOGAT00000009638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAEECTKYKVSTCRDCIQSGPGCSWCQKLNFTGPGEPDSIRCDTREQLLMRGCAADDIMD
PRSLAEAQEDRERGQKQLSPQKVTLYLRPGQAAVFNVTFRRAKGYPIDLYYLMDLSYSML
DDLINVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPEKLRNPCPNKEVGCQA
PFAFRHVLKLTDNANQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPVRLLPLHGSAVSL
TNRHPGPSSHLWHCQPRPGESSPRCLPGGKAGQQGRRMATGPRTSCMCVLSRCWDSGGGG
RWSQIQTTGRAGPAGQDTSTLSTATLCPQKLSSRVFLDHSTLPDTLKVTYDSFCSNGVSH
TGQPRGDCDGVQIGVPVSLPVQVTGNRHXQEQSFVIRALGFTDTVTVQVLPQCECQCRDQ
SRDRSLCHGKGSLECGVCRCDAGYIGKSCECQTQGRSSQELEGSCRKDNNSIVCSGLGDC
ICGQCVCHTSDVPNKQIYGRYCECDNVNCERYDGQVCGGPKRGLCFCGTCSCQTGYEGSA
CQCQSSTDGCLNQWGKECSGRGRCRCNACECYPGYQPPLCQECQGCNFTCSNYTFCAECL
QFNKGPFEKNCSAACRGLQLQKEPLSWRRCKEQDSEGCWMTYTMKQLDGWEQYHIHVEKT
RECVEGPNIAAIIGGTVAGVVLIGVLLLVIWKALTHLSDLREYKRFEKEKLKSQWNNDNP
LFKSATTTVMNPKFAES
Download sequence
Identical sequences H0X0Z0
ENSOGAP00000008621 ENSOGAP00000008621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]