SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008656 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008656
Domain Number 1 Region: 12-363
Classification Level Classification E-value
Superfamily UROD/MetE-like 7.5e-117
Family Uroporphyrinogen decarboxylase, UROD 0.00000000000584
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008656   Gene: ENSOGAG00000009677   Transcript: ENSOGAT00000009681
Sequence length 367
Comment pep:known_by_projection scaffold:OtoGar3:GL873721.1:494210:497802:-1 gene:ENSOGAG00000009677 transcript:ENSOGAT00000009681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCR
SPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLER
LRDPAVVASELDYVFKAITLTRQQLDGRVPLIGFAGAPWTLMTYMVEGSGSNTMAQAKRW
LYQRPQASHQLLHILTDALVPYLVGQVAAGAQALQLFESHAGHLGPQLFTQFALPYIRDV
AKRVKAGLQEAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVVPKKARERVGKMVT
LQGNLDPCALYASKEEIGRLVCQMLDDFGTQRYIANLGHGVYPDMDPEHVGAFVDAVHRH
SRLLQKN
Download sequence
Identical sequences H0X120
ENSOGAP00000008656 ENSOGAP00000008656 XP_012667779.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]