SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008709 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008709
Domain Number 1 Region: 2-355,385-405
Classification Level Classification E-value
Superfamily Thiolase-like 5.14e-75
Family Thiolase-related 0.0021
Further Details:      
 
Domain Number 2 Region: 2223-2498
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.35e-62
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.000000000286
Further Details:      
 
Domain Number 3 Region: 1637-1801
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.9e-41
Family Alcohol dehydrogenase-like, C-terminal domain 0.0000925
Further Details:      
 
Domain Number 4 Region: 490-615,678-775
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.71e-40
Family FabD-like 0.0052
Further Details:      
 
Domain Number 5 Region: 1880-2069
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.36e-34
Family Tyrosine-dependent oxidoreductases 0.00019
Further Details:      
 
Domain Number 6 Region: 1264-1402
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000000000000012
Family Precorrin-6Y methyltransferase (CbiT) 0.028
Further Details:      
 
Domain Number 7 Region: 1551-1671
Classification Level Classification E-value
Superfamily GroES-like 0.00000000000000393
Family Alcohol dehydrogenase-like, N-terminal domain 0.0076
Further Details:      
 
Domain Number 8 Region: 2122-2187
Classification Level Classification E-value
Superfamily ACP-like 0.00000000000772
Family Acyl-carrier protein (ACP) 0.00012
Further Details:      
 
Domain Number 9 Region: 615-671
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000068
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008709   Gene: ENSOGAG00000009734   Transcript: ENSOGAT00000009742
Sequence length 2509
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:964045:979811:1 gene:ENSOGAG00000009734 transcript:ENSOGAT00000009742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVIAGMSGKLPESENMEEFWANLIGGMDMVTDDDRRWKAGLYGLPRRSGKLKDLSKF
DASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPASLRGTHTGVWVGVSGSEASEAL
SRDPETLLGYSMVGCQRAMMANRLSFFFDFKGPSIALDTACSSSLLALQSAFQAIRSGEC
PAAIVGGINLLLKPNTSVQFMKLGMLSPEGACKSFDGAGNGYCRSEAVVAVLLTKKSLAR
RVYATILNAGTNTDGFKEQGVTFPSGEAQEQLIRSLYLPAGLAPESLEYIEAHGTGTKVG
DPQELNSIVRALCASRKDPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGMWPPNLHFH
TPNPEIPALHNGQLQVVDRPLPVRGGNVGINSFGFGGSNVHVILRPNTQLPPAPSAASPR
LLQASGRTPEAVQGLLELGQHHSQDLAFVCMLNDIAATPAAAMPFRGYAVMGSEGSCQEV
QQVPAGERPVWFICSGMGTQWRGMGLSLMHLGGFRDSILRSDEVVKPLGLKVSALLQSTE
DSTFDDIVHSFVSLTAIQIALLDLLSFMGLRPDGIIGHSLGEVACGYADGCLSQEEAVLA
AYWRGQCIKEANIPPGAMAAVGLSWEECKQRCPPGVVPACHNSEDTVTISGPQAAVSEFV
EQLKQEGVFAKEVRTGGMAFHSYFMEAIAPTLLQALKKVIREPRPRSARWLSTSIPEAQW
RGSLARTSSAEYNVNNLVSPVLFQEALRHVPEHAVVLEIAPHALLQAVLKRGLKPSCTII
PLMKKDHRDNLELFLTGVGKVHLAGIHVNPNALFPPVEFPAPRGTPLIAPHIKWDHSQTW
DVPAAEDFPNGYGSSSATVHNIDASPESPDHYLVDHRIDGRVIFPATGYLCLVWKTLART
LGLATEQMPVVFEDVTLHQATILPKTGTVPLEVRLLEASRAFEVSENGNLIVSGKVSPWE
DPDPSLFNHPEDPIPADPAAFRLTQADVYKELRLRGYDYGPHFQGILDANLEGTSGKLLW
RDNWVTFLDTMLQMSILGSGERSLRLPTRITAIHIDPATHQQKVYTLQGETRAADVVVSH
CLSSTVAGGARISRLHASAAPRRQQEQLAPTLEKFCFTPHVEDGCLSASTVLQEELQLCK
GLAQALQSKVTQQGLKMSVPGLGGAQAPQDPPQQGLPRLLWAACQPQLNGNLQLELAQAL
AQERPLLPEDPLLCGLLDSPALKACVDTALENMTSLRMMVVEVLASHGRLYSRIPALLNT
HPMLQLSYTATDRHPQALETAQAVLQQHGVAQGQWDPTDPAPGSLGAADLLVCNTAVAAL
GDPAAALNNMAAALREGGFLLLHALLRGHLLGDTVAFLTSTEPQLRQGLLSQDEWESLFS
KASLHVVGLKKSFYGSALFLCRRLSPQDSPIFLAVEDTSFRWVDSLKSILADSSSRPVWL
TATNCSTSGVVGLVNCLRKEPGGHRIRCILLSNLSSTSPTPEMYPGSTELQKVLQGDLVM
NVHRDGAWGAFRHFPLEQDKPEEQTAHAFVNVLTRGDLSSIRWVCSPLSHAPPTSPSTQL
CTVYYASLNFRDIMLATGKLSPDAIPGKWAARDCMLGMEFSGRDASGKRVMGLVPAEGLA
TSIQLSPDFLWDVPSSWTLEEAASVPVVYTTAYYSLVVRGRMRHGETVLIHSGSGGVGQA
AIAIALSLGCRVFTTVGSAEKRAYLQARFPQLDSSSFANSRDTSFEQHILRHTGGKGVDL
VLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSNNHPLGMAVFLKNVTFHGILLDALFEEA
NEDWREVVALLQAGIRGGVVQPLKRTVFPKAQVEDAFRYMAQGKHIGKVVIQVRPEEPET
VLERVEPILTAAIAKTFCPAHKSYIIAGGLGGFGLELAQWLVLRGAQKLILTSRSGIRTG
YQAKQVREWRRQGVQVLVATSDASSPEGAQALIAEATQLGPVGGVFNLAMVLRDAMLENQ
TPEFFQDVNKPKYSGTLNLDRATREACPELDYFVVFSSVSCGRGNAGQTNYGFANSTMER
ICEKRRQDGLPGLAVQWGAIGDVGVVLEAMGTNDTIIGGTLPQRIASCLEVLDLFLHQPH
AVLSSFVLAEKKATAHGDRDSQRDLVQAVAHILGIRDLAAVNMDSSLADLGLDSLMSVEV
RQTLEREHDLVLSMREVRQLTLRKLQELSSKVDTASESASPVPREGSPARQQAQLNLSTL
LVNPEGPTLTRLNAVQSLERPLFLVHPIEGSTAVFRSLAAKLSIPTYGLQCTRAAPLDSI
HSLAAYYIDCIRQVQPEGPYRIAGYSYGACVAFEMCSQLQAQQGPAPTHNSLFLFDGSHT
YVLAYTQSYRAKLTPGCEAEAETEAMCFFVQQFTDAEHSRVLEALLPLKGLEERVAAAVD
LITKSHHGLDRQELSFAALSFYHKLRAAEQYTPKAKYHGNVTLLRAKTGGAYGEDLGADY
NLSQVCDGKVSVHVIEGDHRTLLEGSGLESIVGIIHGSLAEPRVSVREG
Download sequence
Identical sequences H0X162
ENSOGAP00000008709 XP_003786091.1.62490 XP_012658576.1.62490 ENSOGAP00000008709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]