SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000008770 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000008770
Domain Number 1 Region: 277-380
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.65e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000008770   Gene: ENSOGAG00000009800   Transcript: ENSOGAT00000009808
Sequence length 1124
Comment pep:known_by_projection scaffold:OtoGar3:GL873586.1:5130391:5184239:1 gene:ENSOGAG00000009800 transcript:ENSOGAT00000009808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPCEDLEMPGGQTPDPGRLEAGGEAERWSPQFQLQRKFVESSNREQQDRNRVSEELVMV
VQEMKKYFPSERHNKPSTLDALNYALRCVHSVQANSGFFQTLSQNGASQADVTTYSLEEL
ATIASEHTSKNTDTFVAVFSFLSGRLVHISEQAALTLNCKKGCLESSHFVDLLAPQDVRV
FYTHTARAQLPFWNNWTQRAASQCEPALVKSFFCRIRGGEDRRKQEKYYYPFRIIPYMIH
VRSSAQPESEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHSPGCVFLEVDERAVPLLGYL
PQDLIGTSILTYLHPEDRSLMIAVHQKVLKYAGHPPFEHSPIRFCTQNGDYIILDSSWSS
FVNPWSRKVSFIIGRHKVQTSPLNEDVFATRIKKMNNNDKDITELQEQIHKLLLQPVHVS
ASSGYGSLGSSGSQEQHVSAASSSESSGHCAEEPRKEPMTLQQVYASVNKIKNLGQQLYI
ESMTRSSVKPVTGTCTEPLSADEQKAFSSFQTLRNNSLCTESCEDLRKGQHSPSYQQINC
IDSVIRYLKSYNIPALKRKYVSCANTTSSSSEDDKQNLKADDVQALHAIPKSEMPANEWS
TDAEVGAPRTLSTAALSLGSGISQCSYSSTMVHVPPTEAAEDATLACEPWTLNTQPVPLT
SDEFKPIGLTKAVLSAHTQKEEQNYVDKFRERILSSPYSSYLQQESRNEAKYSFVPGDST
SKQTRSAGCKKGKHKRKKVPAPSASSSSDAGSRPHTRGTLGRTQPQYPPAASCPHALGLS
FPSSVMIPSQAPYLTPAFPLPPVTSLGRGDAAVGTALDHLPEPPSASGLQPLPAFPPPYL
DTVMTIFLHSPPVCPLLSSSFFPYPFLGATDSSEIPPPTAAVAPYPEPSPSVTIQTGVEE
QWETGGEGHPFISSRSSSPLQLNLLQEEMPKSSEFSDHMKRDICPKPEYQCVTGKSENKN
SRPPASELSPLSPHKESQSGARFLIGSSDSSTYFASSDYSSGISPNGQQSQDTQKKEAFP
SSAEEPIWRMIREVPESILMTYQVPERVKEVVLKEDLEKLERMRQQQPRFSHGQKEELAK
IYSWVQSQTVPQEADIQDCATGENKGSIDAAAESCGQDPAEDSS
Download sequence
Identical sequences H0X1B1
ENSOGAP00000008770 ENSOGAP00000008770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]