SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009158 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009158
Domain Number 1 Region: 406-543
Classification Level Classification E-value
Superfamily DNA-glycosylase 8.55e-34
Family Mismatch glycosylase 0.000000152
Further Details:      
 
Domain Number 2 Region: 55-175
Classification Level Classification E-value
Superfamily DNA-binding domain 1.5e-30
Family Methyl-CpG-binding domain, MBD 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009158   Gene: ENSOGAG00000010236   Transcript: ENSOGAT00000010244
Sequence length 547
Comment pep:known_by_projection scaffold:OtoGar3:GL873620.1:6079881:6090394:1 gene:ENSOGAG00000010236 transcript:ENSOGAT00000010244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPSLGDREAAPAITFSERLSPDDILSSLCKEDVAVGLARVEDEKQMMIKRNSECNLLP
QEPIASTQLGGTAVTESHKSVPCGWERVVKQRLSGKTAGRFDVYYISPQGLKFRSKSSLA
NYLHKNGEMSLKPEDFDFSVLSKRVIKSKHKVCSMAILTSQLQNENKNSNWNIRTRSRCK
KDVLPLPNSSVELQDSRGRYNFTSTDLLSEEDTGINDVNFRKVRKPKGKETILKGIPIKK
TKKGCRKSLSGSIRRNRKTESVSNTAASDETLSVTDEEKNLVKEKSLSSGSNFCFEQIDS
GIINKLCLTKEAKHNKYEDTLASEEIRTKEVGERKEHFPIDILKCDSEMDNNGSPTKKDF
TAGEIFQEDTVPRTQIEKRKTSLYFSSKYNKEALSAPRRKAFKKWTPPRSPFNLIQETLF
HDPWKLLIATIFLNRTSGKMAIPVLWEFLEKYPSAEIARTADWRDISELLKPLGLYDLRA
KTIIKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCINEWKQVHPEDHKLNKYHDWLWEN
HEKLSLS
Download sequence
Identical sequences H0X289
ENSOGAP00000009158 ENSOGAP00000009158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]