SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009349 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009349
Domain Number 1 Region: 220-300
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000524
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0071
Further Details:      
 
Domain Number 2 Region: 81-151
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000746
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000009349
Domain Number - Region: 10-49
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0048
Family HLH, helix-loop-helix DNA-binding domain 0.0094
Further Details:      
 
Domain Number - Region: 449-557
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00654
Family Apolipoprotein 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009349   Gene: ENSOGAG00000010446   Transcript: ENSOGAT00000010451
Sequence length 804
Comment pep:known_by_projection scaffold:OtoGar3:GL873653.1:3664321:3669876:-1 gene:ENSOGAG00000010446 transcript:ENSOGAT00000010451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGT
PLEGPSGLLSAEELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIY
DIIDPADHLTVRQQLTLPSALDNDRLFRCRFNTSKSLRRQSTGNKLVLIRGRFHAHPPGA
YWAGNPVFTAFCAPLEPRPRPGPGPGPGPGPASLFLAMFQSRHAKDLVLLDISESVLIYL
GFERSELLCKSWYGLLHPEDLAHASAQHYRLLAESGDIQAEMVVRLQAKPGGWAWIYCLL
YSEGPEGPITANNYPISDMEAWSLRQQLNSEDTQAAYVLGTPTMLPSFPENILAQEQCSS
TNPLFTPALGAPRSTTFPSAPELSVVSASEDIPRPPKGIDFSYLTFPSGPEPSLQGDLSK
DLVCTPPYTPHQPGGCAFLFSLHEPFQTHLPTPSTSLQEQLTPSTATFSDQLTPSSATFP
DPLTSPLQGLLTETSARSYEDQLTPCTSTFPDQLLPSTATFPEPLGSPSREQLTPPSTAF
QAHLNSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPL
SVDVPLVPEGLLTPEASPVKQSFFHYSEKEQNEIDRLIRQISQLAQGMDRPFSAEAGTGG
LEPLGGLEPLDSNLSLPGAGPPVLSLDLKPWKCQELDFLADPDNMFLEETPVEDIFMDLS
TPDPSEEWGSGDPEAEGPGGPPSPCNNLSPEDHSFLEDLATYETAFETGVSAFPYDGFTD
ELHQLQSQVQDSFHEDGSGGEPTF
Download sequence
Identical sequences H0X2Q2
XP_003798399.1.62490 ENSOGAP00000009349 ENSOGAP00000009349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]