SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009424 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009424
Domain Number 1 Region: 19-629
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 1.07e-230
Family Aconitase iron-sulfur domain 1.89e-16
Further Details:      
 
Domain Number 2 Region: 633-887
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 1.59e-83
Family LeuD-like 0.000000000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009424   Gene: ENSOGAG00000010522   Transcript: ENSOGAT00000010531
Sequence length 889
Comment pep:known_by_projection scaffold:OtoGar3:GL873691.1:3519658:3556258:-1 gene:ENSOGAG00000010522 transcript:ENSOGAT00000010531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNPFTHIAEPLDPVQPGKKFFNLKKLEDSRYERLPFSIRVLLEAAVRNCDEFLVKKTDV
ENILNWNVMQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPA
DLVIDHSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSGIIHQV
NLEYLARVVFDRDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIEAEAVMLGQPISMVLP
QVVGYKLMGKPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMC
PEYGATAAFFPVDEVSIRYLEQTGRDEKTVKHIKKYLQTVGMFRDFNDPSQDPDFAQVVE
LDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPDHHNDHKTFIYNKS
EFILTHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLNVKPYIKTSLSPGSGVVTY
YLRESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLVAVGVLSGNRNFEG
RVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAKGQQVFLKDIWPSRDEIQAVE
RQYVIPGMFKEVYQKIETVNESWNALAVPSDKLYFWNPKSTYIKSPPFFENLTLDLQPPK
SIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMV
RGTFANIRLLNKFLNKQAPQTIHLPSGEVLDVFDAAERYQEAGLPLIVLAGKEYGSGSSR
DWAAKGPFLLGIKAILAESYERIHRSNLVGMGVIPLEYLPGENADTLGLTGRERYTVIIP
ENLTPRMKVQVKLDTGKTFQAVMRFDTDVELTYFHNGGILNYMIRKMAK
Download sequence
Identical sequences H0X2W6
ENSOGAP00000009424 XP_003800343.1.62490 XP_012667143.1.62490 ENSOGAP00000009424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]