SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009612 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009612
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.62e-98
Family Carbonic anhydrase 0.0000000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009612   Gene: ENSOGAG00000010741   Transcript: ENSOGAT00000010743
Sequence length 262
Comment pep:known_by_projection scaffold:OtoGar3:GL873523.1:39679856:39711435:-1 gene:ENSOGAG00000010741 transcript:ENSOGAT00000010743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLSWGYAEHNGPVHWNKFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKII
SNSGHSFVVDFDDTEDKSVLRGGPLAGSYRLRQFHLHWGSTDDHGSEHVVDGVKYPAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEHNSQLQKITDILDAIKEKGKQTRFTNF
DPLSLIPPSRDYWTYPGSLTVPPLLESVTWIILKQPINISSQQLAKFRNLLQTAEGEEAA
FLLSNHRPPQPLKGRKVRASFH
Download sequence
Identical sequences H0X3C3
ENSOGAP00000009612 XP_003782560.1.62490 ENSOGAP00000009612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]