SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009615 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009615
Domain Number 1 Region: 58-533
Classification Level Classification E-value
Superfamily ALDH-like 1.27e-167
Family ALDH-like 0.0000000755
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009615   Gene: ENSOGAG00000010743   Transcript: ENSOGAT00000010746
Sequence length 535
Comment pep:known_by_projection scaffold:OtoGar3:GL873545.1:20089640:20118625:1 gene:ENSOGAG00000010743 transcript:ENSOGAT00000010746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCFWLRRSMAPRLRPQPLGGLLCPSAGSLGPASRPAPSLAQLRRYAGGLAGLSAALLR
TDSFVGGHWLPAAATFPVHDPANGAVLGMVADCGVPEARSAVRAAYEAFSSWRAVSAKER
SSLLRKWYDLMIQNKDDLAKIITAENGKPLKEAQGEVLYSALFLEWFSEEARRIYGDIIY
TSAKDKRALVLKQPIGVVAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALAL
AELANQAGIPPGVYNVIPCSRKKTKEVGEALCTDPLVPKISFTGSTATGKILLHHAANSV
KKVSMELGGLAPFIVFDSANVDQAVAGALASKFRNSGQTCVCANRFLVQRGIHDSFVKKF
AEAMKKTLHVGNGFEEGTTQGPLINEKAVEKVEKHVSDAVSKGATLVTGGKRHQLGKNFF
EPTLLSNVSQDMLCSHEETFGPLAPVIKFNTEEEAVTIANATDVGLAGYFYSQDPAQIWR
VAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCFGGL
Download sequence
Identical sequences H0X3C6
XP_003788385.1.62490 ENSOGAP00000009615 ENSOGAP00000009615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]